SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SEI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SEI0
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.33e-67
Family Decarboxylase 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SEI0
Sequence length 239
Comment (tr|K9SEI0|K9SEI0_9CYAN) OMP decarboxylase {ECO:0000256|HAMAP-Rule:MF_01200} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_3717 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MSSMADRIIVPLDVPTEAAAIALLDRLPQVGFWKVGLELFVSSGPSILTVLKERDKRIFL
DLKFHDIPNTVKGACHAAGRYGVDLLTVHAANGKEGLRWAKEAAEAGALETGVLAPRLLA
ITLLTSINARTLAFDLKVPLELPEYVLNMALLAQESGIDGAVCSPQEVQQLRSMCENDFL
LVCPGVRPSWAETGDQKRTMTPAEAVKAGANYLVIGRPITAAPDPAEAFGRICDEMASV
Download sequence
Identical sequences K9SEI0
WP_015173748.1.54702 gi|428227139|ref|YP_007111236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]