SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SF43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SF43
Domain Number 1 Region: 99-257
Classification Level Classification E-value
Superfamily GAF domain-like 6.76e-34
Family GAF domain 0.0028
Further Details:      
 
Domain Number 2 Region: 300-530
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000366
Family PP2C-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SF43
Sequence length 535
Comment (tr|K9SF43|K9SF43_9CYAN) Protein serine/threonine phosphatase with GAF(S) sensor(S) {ECO:0000313|EMBL:AFY68394.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0076 OC=Pseudanabaena.
Sequence
MSQVNLKRLLKKKEVSPIVKNIIEAIGAPISIYDAKGNLLVGSEANPDQARSPIEVGDQT
IGWIVGLPESDDTVIGLIRFLAHNEIDKKRLASEVLNKYTEINLFYELSEKITANLEIPA
VIEIIAEKARRLVKATSGSIMLMNEESGLLEVNFSFGLASTSNIKAIKPSEGIAGAVFAT
GKGEIVNDAASDPRFIAGSNPVGSLICAPLKTRDRVLGVINFSNSDPEVEYTAEDLQLMQ
TLAAQAAQAIENAVLQDNKVKDALARYEIEKGQKMQRDFLPDELKLPKEWELSALFKPAR
QVAGDFYDSFMLPSGGIGVVIADVCDKGVGSALFMALFRSLIRVFSTENDLGSISITQAD
TEKAKGHTQIINLGHVNALRAVKLTNDYVADNHSNLNMFATLFFGIIDPKTGLLTYVNGG
HEPLAIISDTGIKSRLMPTGPAVGMLPGMKFRIQQIELEPGDMLVGYTDGVTEAKNPTSK
FFTENRLVEILEHPESHPSATQLLDRIDQDLMEFIADADQFDDITMIAVRRCPNS
Download sequence
Identical sequences K9SF43
WP_015163368.1.5078 gi|428216357|ref|YP_007100822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]