SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SFG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SFG8
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.42e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 
Weak hits

Sequence:  K9SFG8
Domain Number - Region: 330-417
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00687
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SFG8
Sequence length 440
Comment (tr|K9SFG8|K9SFG8_9CYAN) Ferredoxin--NAD(+) reductase {ECO:0000313|EMBL:AFY68885.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0581 OC=Pseudanabaena.
Sequence
MQKHYFIIGAGVAGITAAEQLRRGDAEASITVINGEDYPFYRRLSLSTYLQGQTTLEALT
VKQPEDYEALNVTVLQDRVAQIKPNENTLVMASGETHNYDGLIIATGGSAIKPPIPGIDL
NGVRLGYWDMKDTLWYEEIAKANNGNDAVVIGGGVLGLELADCFNQAGLKVTIVQLGATL
GEPLTDEVSGEILLNRVKESGAECRIGVMAKEILGDENGNVRAVVTSAGEEIPAKAVGIC
IGIRPNVAFLQDSGIELVNGCIGVDGYLKTNFDNIFAAGDCTWVSSGNMVGYRPNRTWQV
ATNQGTIAAMNLQGMQHPYDEGLFYNAGVLYDLPYTMLGNFNPDPNDESCQVHTYDTAGD
PFAHFKLTVSEGRLVGAMLLGRQRRTNILRKIMEGNFIITGHEHELMDKKFKPKDLPVAD
IQTAGDADVEAKLAAYASKG
Download sequence
Identical sequences K9SFG8
WP_015163859.1.5078 gi|428216848|ref|YP_007101313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]