SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SFK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SFK3
Domain Number 1 Region: 167-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.83e-71
Family Extended AAA-ATPase domain 0.000000063
Further Details:      
 
Domain Number 2 Region: 423-616
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.24e-67
Family FtsH protease domain-like 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SFK3
Sequence length 634
Comment (tr|K9SFK3|K9SFK3_9CYAN) ATP-dependent zinc metalloprotease FtsH {ECO:0000256|HAMAP-Rule:MF_01458} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0670 OC=Pseudanabaena.
Sequence
MPIRNEDPKGPRSWNIGNILLLIGAGLLIFNLVFPLVSGPQIPQVPYSMFVHQVKSGKVE
KAYVGQDQIRYKLKDGIESKDSEVLATTPIFDLELPKMLESNKVEFAAQPPQRGNWFTTL
LGWIIPPVIFVGIFQLFARRGAGGGMPGGLQIGRSKAKVYVEGDAPGIRFDDVAGVDEAK
TELVEVVEFLKTPEKYTSIGAQIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEF
IELFVGVGSSRVRDLFEQAKKQSPCIVFIDELDAIGKSRASGGMLGGNDEREQTLNQLLT
EMDGFTDDGTTVIVLAATNRPEILDPALLRPGRFDRQVLVDRPDKSGREAILKIHAKKVT
LDPEIDLKVVAGRTSGFSGADLANLVNEAALLAARAGRKNVTLADFSEAVERVVAGLEKK
SRVLSDKEKKIVAYHEVGHALVGALSPGSGRVEKISIVPRGMAALGYTLQIPTEDRFLMS
KEELQAQIAVLLGGRSAEEIIFNSITTGAANDLQRATEMAQQMVTNYGMSEILGPLAYQQ
QSNSFLGGGNNTGRELSPATAQLIDKEIKDIVESAHQSAIAILRENRELLETVSEKLLED
EVIEGEFLQEVLAKVSKPEFMEQNANSDRHLQPT
Download sequence
Identical sequences K9SFK3
gi|428216936|ref|YP_007101401.1| WP_015163947.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]