SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SFT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SFT1
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.38e-81
Family Histidine biosynthesis enzymes 0.0000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SFT1
Sequence length 262
Comment (tr|K9SFT1|K9SFT1_9CYAN) ImGP synthase subunit HisF {ECO:0000256|HAMAP-Rule:MF_01013} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0757 OC=Pseudanabaena.
Sequence
MLAKRILPCLDVKAGRVVKGINFVNLKDAGDPVELAQAYNLAGADELVFLDITATHEDRN
IILDVVYRTAEQVFIPLTVGGGVRNVEMIRNLLRAGADKVSMNSAAVRNPDLINQGSDRF
GAQCIVVAIDARRREDPNNPGWDVYVRGGRENTGLDAIAWAEEVVKRGAGEILLTSMDAD
GTQAGYDLDLTRQIADRVGVPVIASGGAGTCAHIHEALTEGKAEAALLASLLHYGQLSIA
EIKEYLISQQVPTRHVAHNGFG
Download sequence
Identical sequences K9SFT1
WP_015164032.1.5078 gi|428217021|ref|YP_007101486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]