SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SHL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SHL6
Domain Number 1 Region: 118-177,230-251
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000186
Family 7-Fe ferredoxin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SHL6
Sequence length 431
Comment (tr|K9SHL6|K9SHL6_9CYAN) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein {ECO:0000313|EMBL:AFY70102.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_1826 OC=Pseudanabaena.
Sequence
MSLSNPFRGINATTDAPLASLRSRQWVKLICGASYQDLPKIRNLALVYALAGVDCIDMAA
DPAVITAVREGVAVARLLYQKAFAPNASTDTEINAELDLDLDLEPLDISDLNINNQINNQ
AAPNPWLMVSLNAGEDPHFRKAEFNYLECLTHCDRPCVDVCPTQAIQFNQVEVHNDRAGL
SERNNQIREQGKSGNSGNSGNSEDLSFTSSASHLSNLATKPQGEVLDNLCYGCGRCLAVC
PLSIINTREHTYTPEILLNEPIDAIEIHIQPWRVEEFKRLWQRLLPVIPKLKLLAISFPD
CDNLKDYLLALLEWMKPLPQQLVWQADGRPMSGDIGNGTTQAAIKLGQKVLGFELPIGFV
QIAGGTNASTARKIDEAQVKVAGVAYGSYARKLIMDLLEQGGDRLEANPQLLKQAILKAK
NLVGQTKHKAS
Download sequence
Identical sequences K9SHL6
gi|428218065|ref|YP_007102530.1| WP_015165068.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]