SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SK36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SK36
Domain Number 1 Region: 18-245
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.42e-66
Family Decarboxylase 0.00000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SK36
Sequence length 249
Comment (tr|K9SK36|K9SK36_9CYAN) OMP decarboxylase {ECO:0000256|HAMAP-Rule:MF_01200} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_2717 OC=Pseudanabaena.
Sequence
MSNQPATQPEKSEPTNLQERIIVAIDVPTIDAALALCDRLPQVGFWKVGLELFVSTGAEI
LTELKQRQKKIFLDLKLHDIPNTVAAATRAAVKYEVDFLTVHAVGGRNMLKAAQAEVVDS
NTRLLAITLLTSLSSRELAFDLKIPLELPEYALQMALMAQDCGLYGAVCSPLEVSGLRSL
LPPNPTGAEFGLVTPGIRPAGSEQGDQRRTMTPAQAIAAGASYLVIGRPITQAEDPAAAW
QEICAQLSN
Download sequence
Identical sequences K9SK36
gi|428218935|ref|YP_007103400.1| WP_015165928.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]