SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SML4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SML4
Domain Number 1 Region: 157-263
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 7.95e-20
Family TonB 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SML4
Sequence length 375
Comment (tr|K9SML4|K9SML4_9CYAN) TonB family protein {ECO:0000313|EMBL:AFY71448.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_3201 OC=Pseudanabaena.
Sequence
MHRSSYCDRKRNEEMRLLLIVGLGSILSSTLFHMVVIAFGRLPDWRSSQSLDDENYIEIV
VVEPPAEDIPEVIEPPEITPEPPPLLVQPEIAAVPFVPEQPIIQESTPQPLEPNFDNLLQ
DLVPTDSAESSSVSVPVAPALPGNTFDPTKLIRVIAPKAPPVPPAPPAPPARRGSDRGGV
VCQNCPKPNYPRSARRDGVEGQPKVTFDVDENGKPTNIRIKNSSGNSELDQAAVEAVQEW
QLDPNSSSNAEDVSATINFELEGSQRQRRRRERDRRRRRREERTRPPEPVAAPANPAPDV
SNSVPEAPIATPEAPPENLLEGPASEPAAPAPVVPEQPETPAIEDTGTPAPVESAPAPIA
PPPPPPVEASESSSE
Download sequence
Identical sequences K9SML4
gi|428219411|ref|YP_007103876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]