SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SRP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SRP0
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.4e-77
Family D-ribulose-5-phosphate 3-epimerase 0.0000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SRP0
Sequence length 229
Comment (tr|K9SRP0|K9SRP0_9SYNE) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_00657 OC=Synechococcus.
Sequence
MAPKSTVIAPSILSADFSRLGDEIRAIDAAGADWIHVDVMDGRFVPNITIGPLVVEAIRP
VTKKPLDVHLMIVEPEKYVADFAKAGADHIYVHAEHNASPHLHRTLGQIKELGKLAGVVL
NPGSPLELIKYSLELCDLVLIMSVNPGFGGQSFIPEVVPKIRELRQLCDEKGLDPWIEVD
GGLKANNTWQVLEAGANAIVAGSAVFKAKDYAKAIADIRNSKRPELVLA
Download sequence
Identical sequences K9SRP0
gi|428220770|ref|YP_007104940.1| WP_015167464.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]