SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SSE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9SSE7
Domain Number - Region: 15-45
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0116
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SSE7
Sequence length 70
Comment (tr|K9SSE7|K9SSE7_9SYNE) Uncharacterized protein {ECO:0000313|EMBL:AFY73158.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_01048 OC=Synechococcus.
Sequence
MSEIIFPGSAVRVSNVADTYYGFEGQVQRVSDGRVAVLFEGGNWDKLVSFRPTELELVDA
TLSRNKGRKK
Download sequence
Identical sequences K9SSE7
gi|428221123|ref|YP_007105293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]