SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SVJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SVJ5
Domain Number 1 Region: 28-170
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-23
Family GAF domain 0.022
Further Details:      
 
Domain Number 2 Region: 232-438
Classification Level Classification E-value
Superfamily PP2C-like 0.000000201
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SVJ5
Sequence length 440
Comment (tr|K9SVJ5|K9SVJ5_9SYNE) Serine phosphatase RsbU, regulator of sigma subunit {ECO:0000313|EMBL:AFY73774.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_01722 OC=Synechococcus.
Sequence
MKAPIPDNEQARLAALYQYQILDTVAEVLFDDFTHLASQICGMPIALISLIDHDRQWFKS
KLGLESSETPRDQAFCAHAILNPDQPLIVEDATADVRFADNPLVTGDTNIRFYGGFPLVT
PDDFAIGTLCVIDQKPRTLMPEQEAALKMLSRQVISQLELRLKLQEIEERTKDLEQANGI
INCLNEKLAAENIRMGAELSVAQKIQMMILPKVGELELIPELDVAAYMEPAAEVGGDYYD
VIYHDGRVKIAIGDVTGHGLSSGIIMLMAQTAVRTLIGAGETNPVKFLGAVNQTLYDNAH
RMDSCKNMTLTILEYANQTLRVSGQHEEIIIVRRDGSLERLDTMDLGFPLGLELDIDAFI
GEAVIDLQPDDLVLLYTDGIPEATNSENQFYGLERMCAIAQKYHHLSATDVCKAVIKDVM
HFIGQQKIYDDITLIILKQR
Download sequence
Identical sequences K9SVJ5
WP_015168431.1.58188 gi|428221739|ref|YP_007105909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]