SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SVS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SVS9
Domain Number 1 Region: 82-360
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.07e-66
Family Alanine racemase-like, N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 468-573
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000593
Family Eukaryotic ODC-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SVS9
Sequence length 645
Comment (tr|K9SVS9|K9SVS9_9SYNE) Biosynthetic arginine decarboxylase {ECO:0000256|HAMAP-Rule:MF_01417} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_02027 OC=Synechococcus.
Sequence
MAQETTLPILVKNLTELKTWTIQNSEELYRINGWGEPYFSINEAGHVTVSPKGDRGGCID
LFDLINDLKERNLRLPILLRFSDILADRIERLNACFAKAIARYNYNGVYRGVYPVKVNQQ
RQLVEELVNYGKSFQFGLEAGSKPELLIALATLKTPGALLICNGYKDLEYVETAILARRL
GQTPIIVLEQLEEVDLVIKAAKNLNIQPILGVRAKLSSKGIGRWADSAGDRAKFGLNMWE
ILEVLEKLKAADLLGSLQLLHFHIGSQISSIGVIKDALREASQIFVQLSKSGADMKYIDV
GGGLGVDYDGSKTNFYASKNYNMQNYAYDVVAEIKEACAENHIPMPTLVSESGRAIASHQ
SVLIFDVLNVSGIPSHDIPPLEEGEHLIIRNLFETLEQINVDTYQEAYHDATQFKEEAVS
LFSFGYLNLSQRARVERLYWEACDRILKIVRQQNYVPDDLEDLEKIMATTYYCNFSVFQS
APDSWAIDQLFPIMPIHRLNEEPTCRGTIADLTCDSDGKIDKFIDLRDVKSVLELHPFDP
NQPYFLGLFLGGAYQEILGDLHNLFGDTDAVHIHVTPNGYQVEHVIKGDTMTEVLEYVQY
SRDGLLESMRRETEKALQAKTITLEEARLLLQKYDHSLSGYTYLS
Download sequence
Identical sequences K9SVS9
WP_015168708.1.58188 gi|428222016|ref|YP_007106186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]