SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SWD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SWD6
Domain Number 1 Region: 4-192,244-383
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.74e-71
Family TK-like PP module 0.008
Further Details:      
 
Domain Number 2 Region: 318-508
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.81e-60
Family TK-like Pyr module 0.017
Further Details:      
 
Domain Number 3 Region: 494-625
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.9e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SWD6
Sequence length 641
Comment (tr|K9SWD6|K9SWD6_9SYNE) 1-deoxyxylulose-5-phosphate synthase {ECO:0000256|HAMAP-Rule:MF_00315} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_02228 OC=Synechococcus.
Sequence
MRLSEITHPNQLHRLSIAQLESIAQEIRNKHLETIAATGGHLGPGLGVVELTLALYQTLD
LDHDKVVWDVGHQAYPHKLITGRYDRFHTLRQKDGVAGYLKRSESKFDHFGAGHASTSIS
AALGMAIARDAKGENFKTVAIIGDGALTGGMALEAINHAGHLPKTNLMVVLNDNEMSISA
NVGAIPRYLNRLRLTQPVKFLSGTIEEQVRNLPFVGGSLGDELDRIKDNIKILTMVQNKV
GAVFEELGFTYIGPIDGHNLKELIDTFQMAHKLQGPVMVHVATTKGKGYSYAEADRVGYH
AQGSFNLDTGKSAPSSKPKPPSYSKVFVDTLIKLAEKDKRIIGITAAMATGTGLDKLQAK
LPEQYIDVGIAEQHAVTLAAGLACEGMRPVAAIYSTFLQRAFDQIIHDVCIQKLHVFFCL
DRAGIVGADGPTHQGMYDIAYLRCIPNIVLMAPKDEAELQQMVVTGLEYDGAIAMRYPRG
NGYGVPLKSENWEPIPIGKAEVLREGKDVLLVAFGSMVYPALQAAEILMEHGVQATVVNA
RFAKPLDMDLIAPLAQTISRVVTLEEGCLMGGFGSAVLEALMDLQILVPVHRIGVPDVLV
DHASPEQSFAELGLTSGQISDRILAEIQPEGAKQKADLIQK
Download sequence
Identical sequences K9SWD6
WP_015168893.1.58188 gi|428222201|ref|YP_007106371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]