SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9U087 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9U087
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-47
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 1603-1766
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-44
Family Histidine kinase 0.00099
Further Details:      
 
Domain Number 3 Region: 1791-1920
Classification Level Classification E-value
Superfamily CheY-like 1.71e-35
Family CheY-related 0.004
Further Details:      
 
Domain Number 4 Region: 1330-1512
Classification Level Classification E-value
Superfamily GAF domain-like 1.2e-25
Family GAF domain 0.0054
Further Details:      
 
Domain Number 5 Region: 1540-1615
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-22
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 6 Region: 297-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-21
Family G proteins 0.063
Further Details:      
 
Weak hits

Sequence:  K9U087
Domain Number - Region: 1121-1155,1197-1276
Classification Level Classification E-value
Superfamily TPR-like 0.00398
Family CT2138-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9U087
Sequence length 2004
Comment (tr|K9U087|K9U087_9CYAN) ATP-binding region ATPase domain protein {ECO:0000313|EMBL:AFY88497.1} KW=Complete proteome; Reference proteome OX=251229 OS=Chroococcidiopsis thermalis PCC 7203. GN=Chro_3030 OC=Chroococcidiopsidaceae; Chroococcidiopsis.
Sequence
MSMAIAGYTLLEVITECTNTTVYRAYRDTDKTSVIIKTPKAERTSIEELTYLKHEYNILH
DLKLTGFVQPLALESYQSGLALIYADFSGISLKRLLESQKKIGLISFLSIAIQLVSAVAQ
LHQHNIIHKDIQPCNILVNPETGQAIFIDLSLASRLPIENQTIRHPELLEGNLAYISPEQ
TGRMNRALDYRTDFYSLGVTFYEMLTGQLPFQANNPLELIHSHIAKAAISPREHQPEIPP
AIAQIVMKLLAKTAEDRYQSALGLKADLETCLRMLQTTQKISSFRAGQLDLSSQFLIPQK
LYGREREVATLIDAFDRVSRGATEMMLVSGYSGVGKSSLVNEVHRPIVGARGYFISGKFD
QFKRNIPYASLIQAFQELIRQLLTESSDRIASWQAKLLTALGSNGQIIIDVIPEVERIIG
VQPAVPSLGITESQNRFNRVFRQFIHVFTQPEHPLVIFLDDLQWVDLASLKLIQLLVCDS
HSQYLLLIGAYRDNEVNSSHPLISTLAEIQQAHVVTNNIVLQPLQIIHTNQLIADTLRTN
TTTTKALAELVFKKTQGNPFFLTQLLKSLYQEKLLTFDFDRAGWQWDIHVLQEIDITNNV
VELMVSQIQKLSPKTQKVLKFAACIGDKFTLDILAIVNEKSLLETAKDLWEALQVNLISP
LSEAYKIPLVIEPDTSKILLVKPLKVSYKFLHDRVQQAAYSLIPDSQKQATHLKIGQLLL
KNTAIEERKENIFALVNHLNYGADLLTLDAEKSELAELNLIAGQKAKAATAYESAMRYFK
MGLGLLTANSWQNQYELTLALYESAVETAYLNGDFEQMEQWATIVLQQAKSPIDKMKVYE
VKIQTCMAQVKQLEAIAIGLQALELLGVRLPQSPSPLDLQHALSRTATNLAGKNIEDLIN
LPLMTEVDKLAAIRMLTSLGSPTYQAAPMLFPLVVCEQVNLSLEFGNTPFSAYGYVCYGV
ILNGIVEDVESAYQFGKLALNLVERFNTLELKTSVFFVAGSCTMHGKVHAKETLPLLLNG
YQNGLENGHFEYGGYAAMQRCQYSYFTGQELANLERDMANVSDALLQLKQENALSWNQIF
QQSVANLLEPTQNRCCLLGKAYNEERSLPLLQKANDRTGLHYFYINKLILCYLFGEYEQA
LENADRAVQYLDGVKAFLVVPVFYFYDSLAQIAMYPSASRSQQEQLLDRVLNNQKKMQKW
AGYAPMNFQHKYELVEAEQARVLGQYWQAMESYDRAVAGAREHGYIQEEALANELAAKFY
FSQGRDKIAQVYLVEAYYGYLHWGATAKVKDIEIKYPQILVRFPKQEAVLDNVSQSLSPI
SIENPKNLDLATVIKASQAVSGEIVFDNLLTKLMQIVLENAGAEKGYLILDKAGELYIET
AGGIDLDEIAVREALPFRISETFENHPILPISAINYVARTLESVVLNDATDKEIFASDSY
IVARQPKSILCTPILHQGKLTGILYLENNLTTGAFTPDRLEILQLLSAQAAISIENARLY
HDLENYNQSLETKVAERTLELQAKNVQLQQEIGDRQRAEIAAEAASQAKSEFLANMSHEL
RTPLNGILGYAQILKKEKALTEQQKNGLDIIHRCGDHLLTLIDDILDISKIEAQKMELDC
HDFNFLEFLAGIVDICQIRAEPKGICLTYELSNLPQFIRADEKRLRQVLLNLLGNAVKFT
EKGSVTFKVSDRAGKLRFQVEDTGIGMAVEQLEEIFLPFQQVGRHRDRVEGTGLGLAISK
QLVQKMGGDIKVKSTLGQGSVFWFELELPRIYQLAEVTNISKQRIIGFQGNKLKVLVIDD
KWSNRSVIVNMLEPLGFEVLEAIDGLDGLAKAQAFQPDCVILDLVMPGMDGFEVTRHLRT
LPELTGVVAIAISASVFDFDRQQSQAVGCDDFLPKPVRETDLLEKLRIHLGLQWIYEEES
TEKALDNSSASELATGAIVPPPAEEMVKLLDLAMRGDIRGIIEQAVRIEALDRRYRPFAL
HLRQLAKSYKEKQILEFVKKYLDI
Download sequence
Identical sequences K9U087
WP_015155044.1.72800 gi|428208013|ref|YP_007092366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]