SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9VU81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9VU81
Domain Number 1 Region: 28-143
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000724
Family Carbon-carbon bond hydrolase 0.09
Further Details:      
 
Weak hits

Sequence:  K9VU81
Domain Number - Region: 186-246
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.093
Family PG130-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9VU81
Sequence length 256
Comment (tr|K9VU81|K9VU81_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ11109.1} KW=Complete proteome; Reference proteome OX=1173022 OS=Crinalium epipsammum PCC 9333. GN=Cri9333_0109 OC=Gomontiellaceae; Crinalium.
Sequence
MEWQEVNGNWVYIPQYHTGIVHFLGGAFVATAPHVTYRLLLEDLASKNYAIIATPFVNTF
DHTAIAKSVHQSFDRTIEQLRAKSLLRRRYLPIYGVGHSMGCKLHLLIGSLFPVERAGNI
LISFNNFAARDAVPLVEQFSGAFTVEFTPSPLETISLISQRYQVKRNLIIKFNNDNLDQS
LALRETLDKRFPGMITSQILKGSHVTPLGQDFKWQVSSVYTPFDALGQWMKQEVYRDLHQ
LKQEMLRWLNPLAINN
Download sequence
Identical sequences K9VU81
gi|428303794|ref|YP_007140619.1| WP_015201253.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]