SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9W9R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9W9R2
Domain Number 1 Region: 229-529
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-89
Family WD40-repeat 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9W9R2
Sequence length 531
Comment (tr|K9W9R2|K9W9R2_9CYAN) WD40 repeat-containing protein {ECO:0000313|EMBL:AFZ16242.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0313 OC=Microcoleaceae; Microcoleus.
Sequence
MLKHRLLIAEFIFLLASVIGWVIAVRTGLLIYAAVPVTIALLLNLLNRLRLEEQMKRRLT
VAINQLERQLKQENYTVQEQQLEKAIASLKAQIPEYLAQIESSELDSSALKIIQFKGQLT
GLEESLNSIVQYLNSASLPSRVERLEEVIASTTAELHWLERQLTDTTHSRSDQPQNPLPT
LQPEGVPVVNESQHFTSDPTHSIPVESSTLAPFQDSVSVEESSDFSLPPQTWSLLNTLTG
HLDWIHALAITPDGQTLVSGSFDKTIKVWHLPTRKLLHTLSKHTKGVLCLAISADGKILA
SGSFDEKIHLWRLDTGELIGTLKGHTSSVRSLAMSENGQMLISGSFDETIKLWRLDRGEC
LGNLSQWTGQVSAIALSSDGQTLASGGGDGIISLRLLDTTDGEINPSPAITLTGNLSSVC
SLAMTSDGEILAAGCTDGNIKLWKLETLELLGIFTGHAGPVMSVVFSIDTPTLISASADG
TVMIWHIKTGQQLGILRDDSAASVMAVAISSDGQWIASGGADSMIKIWQRD
Download sequence
Identical sequences K9W9R2
WP_015180406.1.75295 gi|428308671|ref|YP_007119648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]