SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WA29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9WA29
Domain Number - Region: 29-81,151-183
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000481
Family HD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WA29
Sequence length 496
Comment (tr|K9WA29|K9WA29_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ17073.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1182 OC=Microcoleaceae; Microcoleus.
Sequence
MDLEVAHTRCKDRLVWAIEQLQGKVEPTQLEIITELIIQTMTGPWRYFHTPDHIFEVGGS
VNAVEVLAALFHDLVYVQVDHGVSINIGSYIAPFVKEVKGIEVKEAKGKGAKGQLVIRES
SDMPASAMFDIVATIFGFSPNQVLSPMAGQNEFLSALIAARSLEPVLSPGVIAQIVACIE
ATIPFRPLSPSGLTPSEMLYQRLIAANQQFNFGWNEPQIIEIVKRCVRLSNRDVENFAYP
NSADFLDNTWNLLPETNHELIHANSYTVAGYRRSLQNMEGFMNFLSPEQVFQRFMGEPDD
ETYQELILKTRKNLEVAKLYLGCKLVSIAIIEALSRRLVGGRDRDIPLSTMMGELPIAGL
KTPSLEQFLPDIPSVHPPETPLEREVLELLRKGRNQDSSYDLKNSPIATFIVNAMGFPSV
RHLIQRAKEFFAGKLSTDEFLRECDYKAIRTVIDAVEQLFESRANALRGLSGETTLTFEP
YPAAISKLGQEVVSEV
Download sequence
Identical sequences K9WA29
gi|428309502|ref|YP_007120479.1| WP_015181233.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]