SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WAT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WAT7
Domain Number 1 Region: 872-1041
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-40
Family Histidine kinase 0.00072
Further Details:      
 
Domain Number 2 Region: 101-229
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.083
Further Details:      
 
Domain Number 3 Region: 532-664
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.085
Further Details:      
 
Domain Number 4 Region: 663-793
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-21
Family Heme-binding PAS domain 0.061
Further Details:      
 
Domain Number 5 Region: 801-882
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000255
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 
Domain Number 6 Region: 272-411
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000613
Family GAF domain 0.011
Further Details:      
 
Domain Number 7 Region: 415-533
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000332
Family Heme-binding PAS domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WAT7
Sequence length 1067
Comment (tr|K9WAT7|K9WAT7_9CYAN) GAF sensor signal transduction histidine kinase {ECO:0000313|EMBL:AFZ16889.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0994 OC=Microcoleaceae; Microcoleus.
Sequence
MMLKVLQILSDNFFISNGYNRLWESSIFRVQIDNTFIIIFSSFSIFLILVHFLRQRPDMP
SEEALQQAKNQLEIRVEERTQELRQALAELKEVILQLQWEIGQRQQVEASLREREEQYRS
VVDNVKEVIFQTDVNGYWTFLNPAWSEITDFAIAGSLGTFFLDYVHPDDRQRNLYEFQLL
IAGKQEYCRHEVRYRTACGSYRWIEVFTQLTFDANRKITGTCGTLYDITERHLSEEVLAE
RERYLAALVEVQRRLLAFEKDTQQGLIKQKPYNEILEVLGQVADASRVYVFENYRDEQGR
LLMSQQAEWCAPGMPPKMESQTVQNLSYDDVFPRWSQVLSQNEIIAGIITEFPESERVVL
APQGILSILILPLTVNGTFFGFIGFDNCTEGHPWQASEVDLLTSAAAAVSLWNESFLAQQ
ALRQSEAVNRALLEAIPDALVRIHRDGTYLDFIPAKNRQTPISAHAFLGKKIASLLPHEL
ALKLSADVAATLSTGKVQVSEAPIQIKGERRHYEIRSVFYSQDEVLIMGRDVTEQKQAEA
ALRESEERFRSLVDHIPGVVYRRAYDADWTIDFISDFMEEMIGYPAADFLHNQVRTFTSV
IAPEDRTRVERVVAECIALRKPYVIEYRLVGKDGSIRWVYEKGQGVFAADGSLLCLDGVL
FDITDYRKTQEDLRLREEQFRQLTENIHEVFFLTLPDLSQILYISPAYEDLWGRTTQSLY
EQPQSWLDSVHPEDRDRVVAALTPHLQQVQDFDEEYRIVRPDGSVRWIWVRACHILHKVD
SPARIAGIAEDVTERKLAEVEILNALAKEKELGDLKSRFISITSHEFRTPLATIMSTAEL
LEYYEWTQEDKVEQLHLIQDAVKHMLQLLEDSLFIGTAEAGQVRFNPEPLVLNEFCQDLV
TEMQRGMSLNPTPSGIPHTLTLVCRGHRFLACMDKKLLRQLLSNLLCNAIKYSPAGGQVH
FELTCQDDKAIFQIQDQGIGIPKEEQSRLFEFFYRAKNVGAIAGTGLGLAIVKTCVDLHR
GEIAVESEVGIGTRFTVSLPLKNHFSLPMLNCLPPHPHQPTRLGDAS
Download sequence
Identical sequences K9WAT7
gi|428309318|ref|YP_007120295.1| WP_015181049.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]