SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WAX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WAX9
Domain Number 1 Region: 42-164
Classification Level Classification E-value
Superfamily TPR-like 5.31e-25
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WAX9
Sequence length 176
Comment (tr|K9WAX9|K9WAX9_9CYAN) Tetratricopeptide repeat protein {ECO:0000313|EMBL:AFZ16652.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0740 OC=Microcoleaceae; Microcoleus.
Sequence
MMENSLPIVYLFTLLVLLGAAGWAIVRQVLKTRKIETALSRLEKKLKKERGTVQEYYELG
SIYADKKMFAQSIGLFQKALKGVDVEEENLAPVHNALGFSYFAQEQYDIAIREYKEAIKL
DPGYVTALNNLGHVYERKKLTAQALQTYEEALKYEPDNATAKRRAESLRKRLVPSS
Download sequence
Identical sequences K9WAX9
gi|428309081|ref|YP_007120058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]