SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WBF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WBF9
Domain Number 1 Region: 172-546
Classification Level Classification E-value
Superfamily TPR-like 7.59e-30
Family Tetratricopeptide repeat (TPR) 0.0062
Further Details:      
 
Domain Number 2 Region: 48-165
Classification Level Classification E-value
Superfamily TPR-like 6.64e-21
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WBF9
Sequence length 1150
Comment (tr|K9WBF9|K9WBF9_9CYAN) Tetratricopeptide repeat protein {ECO:0000313|EMBL:AFZ17725.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1869 OC=Microcoleaceae; Microcoleus.
Sequence
MKGKAPVRKALPWAVTLITVMELLGGVPAPVVGQANPPQSAQQSAELEEAKRLNQQVVQL
INQGQYAAAIPLAERTLDILEKVLGKEHPVVASSLNNLANLYVEMGNYSQAEPLYQRSLA
ISEKVLGKEHPDVAQSLNNLVALYHTQGNYSQAEPLVQRSLAIREKVLGKDHPDVAQSLN
NLAELYKAQGNYSQAEPLYQRSLAIEEKVLGKDHPEVAQSLNNLARLYEVQGNYSQAEPL
YQRSLAIREKVLGSEHPDFATGLYALAVLYQAQGNYSQAEPLYQRSLAISERVLGSEHPD
FATSLNGLASLYIAQGNYSQAEPLLQRSLAIRERVLGKEHPDVALSLNNLAGLYQVQGNY
SQAEPLYQRSLAIREKVLGSEHPDVAQSLNNLGGLYNAQGNYSQAEPLLQRSLAILEKAL
GKEHSLVATSLGNLAILYQYMGNYSQAEPLYQRSIAIEEKVLGKEHPDVAQSLNNLANLY
NAQGNYSQAEPLLQRSLAILEKALGKEQPHIATSLRNLAWLYQAQGDTARALEFKTRATN
IEERNLALILTTGSEARKRAYMATLSGYTNANISLHVQGVPNNPEAARLALTTTLQRKGR
ILDALTDSLQTLRQNLKPEDQTLLSQLADTRSQLAALIFNKPEDIPLEQYQQQVATLKAQ
AEQLENTLSRRSAEFRTETQPVTIEAVQQLIPTDTALVELVQYKPFNAKATKQNEKWGKP
RYVAYILHSKGNIQWIDLGEAAPINQAVEDFRNALQSPTSTIKPIARTLDELLMQPIRQK
LGNTRTILLSPDSQLNLIPFAALVDENNRYLVENYSINYLSSGRDLLRLQNHTPSRSESV
IVANPDYDKPGNPSVKIASQRGTSPPTPLLRGEGSRSNSNLVPPFPAREAGALVRRLGGL
GQTRSTENQRSSDLSQFQFGPLPGTAKEAAAITPMLPGVTLLTGSDATENAIKQLQAPKI
LHIATHGFFLSDVELVAPADFGGSTFLSNRGLGVEARPGIVPNSPPGKTENPLLRSGIAL
AGFNPRQSGTEDGVLTALETASLNLRGTKLVVLSACETGLGDVANGEGVYGLRRALSIAG
AESQAISLWKVSDEGTKDLMVSYYQRLLNNVGRSEAMRQTQLEMLQNPTYQHPFYWAAFI
PSGNWTAMGY
Download sequence
Identical sequences K9WBF9
gi|428310154|ref|YP_007121131.1| WP_015181877.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]