SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WC33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WC33
Domain Number 1 Region: 306-383
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000562
Family TonB 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WC33
Sequence length 632
Comment (tr|K9WC33|K9WC33_9CYAN) TonB family protein {ECO:0000313|EMBL:AFZ17324.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1446 OC=Microcoleaceae; Microcoleus.
Sequence
MSYASSSKSFPDFLKTLPHKLSQPTAIAVIASVGIHAALGFSLPYFSTSSQEKPKPIRNV
QLLELKPEELSRVPPSPLPLDPLSPSLNQQLTPLSPSGSSTFPSLPSFSSNTPSLGDLPS
FDPLPSLGGSGNVPGRATNLGKLARNSPVRTQIKRNPGEPPLPSEVFNSQGGKSSANPQF
KIATGSKITSSPNLRPDVGGLTRGLLPANDNLPLLERFNSNQTSRSFPPPPPAGAIAVNP
GVTGTPFQNQVGATPSMSAFGQTTQATAPASGQGSLTSETATRNFNAFVQRQEDWKKRHQ
VSGELQELPLTVGKYPEKARAAGVDRGSLQVNWMVDKNGNIIADSLEIIGSSGDGVFDEE
ALAAVRKLSIPATGQDKAYTVRVIFYDDSAVPGSVTGSPNSTDGKNSADRQNLPQRLTPT
DRQNSPQRLSPAEQLTPPEQRNSPEWSTPSERKIPSVRPNSSEQPNPTEGKNPTEQPNSS
QQPNPTEEKKPTQPLTPPKGENSTERSTPTEQISPPKRENSTERSTPTEQISPPKRENST
ERSTPTEQISPPKRENSTERSTPTERISPPKRENSTERSTPTERISPPKRENSTEPRSSS
ESQNSEKPQKLPQPQSSEKPQRLPQLPNSVKP
Download sequence
Identical sequences K9WC33
gi|428309753|ref|YP_007120730.1| WP_015181481.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]