SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WC85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WC85
Domain Number 1 Region: 10-90
Classification Level Classification E-value
Superfamily TPR-like 0.00000000204
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WC85
Sequence length 140
Comment (tr|K9WC85|K9WC85_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ17853.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2006 OC=Microcoleaceae; Microcoleus.
Sequence
MTESITSMFDIGLERYNAGEGPDTLLPVFKEICDRSPKTAAAWSCLAWLYLLDNKPEQAY
KTALKGVKLDQSAPQARVNLAIAMLEIGQTGVRKHIDVARQLMAMDSQVRHDLMESLEDG
LNRKPDWQSLKRVQSWLSES
Download sequence
Identical sequences K9WC85
WP_015182005.1.75295 gi|428310282|ref|YP_007121259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]