SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WCC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WCC3
Domain Number 1 Region: 666-966
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.32e-67
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 457-626
Classification Level Classification E-value
Superfamily GAF domain-like 9.38e-39
Family GAF domain 0.0013
Further Details:      
 
Domain Number 3 Region: 401-447
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000719
Family HAMP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 163-267
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000471
Family Sensory domain of two-component sensor kinase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WCC3
Sequence length 967
Comment (tr|K9WCC3|K9WCC3_9CYAN) Methyl-accepting chemotaxis protein {ECO:0000313|EMBL:AFZ17147.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1258 OC=Microcoleaceae; Microcoleus.
Sequence
MTQLSPKPGSNRNPNHNGNGRGSSFKSNHPEERNSAIHYSPSNRQLQSPLDGNTLQQPLL
EMPPIPVPANYTRPRWEWGKWFSTSLRVKTTVIAILIGTLPVVSIGTVAYLTTSQQLRQQ
VLQKEQFDMGDMKDKIYFFIKERVGDMDSLSNMPNFKDAKVRDLLKREEKEEALNRFAST
YSMYDSIAVFDLKGNLIAQSKSEPLPNHWDRDYFQQALKTDKLFITEPRRSETGEGVFLF
VAAPIKDGATNQTIAIVRSRIPIKHLQEVFNINAERGQKLFVVDASGKIATAANDQLVGK
KLEEVFPTLLTKITPKDLKQNEVKNIVGTSLDEQTPQEQILTYSRADRLRPLFGLDWSFV
LARSAKQAFVAEEQLLWTLFLGTASATLLVGAIAAFIANRATRPIVEAAQAVEKIGQGQL
DTRVDIAGEDELAILGGNINDMAGQLEVFTREQTLAAEQALLVAKVTGSRAENSKDLEDL
FKDMIEETRQILNVDRVLIYRFNPDFSGYITAESVAAGFPRAFSNKAESFYLSELREGTD
PEDLVIAIDNIAHTNLQADHLQLLERWRVKAKLEVPILHEGQPYGLLIAHHCKTTYEWQE
SEVGFLKQLAAQMGLSLDRVLLLEQTEQLAEEQRDLKEGLQKRALELLMEVDPISKGDLT
IRARVTADEIGTIADSYNATVGNLRKIVTQVQNASSQVAQTTSTSEVSVRDLSVEALRQA
EKIAVALKRSQDMAQSVQIVANSAKQAEVAVQQAQDTVHEGDTAMNRTVDGILAIRDTVA
ETAKKVKHLGESSQKISTVVNLISTFAAQTNLLALNASIEAARAGEEGRGFAVVADEVRS
LAQQSAEATIEIEKLVAAIQGETNEVVAAMEAGTEQVVMGTKLVDETRQSLNKIATASSQ
INKLVEEIAQATVVQSQASEAVTETMTDVAAIAQKTSTGASLVSESFKELLAVAQSLQED
VGQFRVS
Download sequence
Identical sequences K9WCC3
WP_015181307.1.75295 gi|428309576|ref|YP_007120553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]