SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WD29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WD29
Domain Number 1 Region: 324-486
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.24e-39
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 265-333
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000102
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WD29
Sequence length 500
Comment (tr|K9WD29|K9WD29_9CYAN) Histidine kinase {ECO:0000313|EMBL:AFZ17711.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1855 OC=Microcoleaceae; Microcoleus.
Sequence
MTLPSSQGLSLYQLALEALGISQSFRVSCDTLKSLVGALIDVLIEGKISATLWVKLPPRV
GWLSELKRYQQQAFMAHKIYLCNGRKEDLLETKDGVVQLANVKPESQFFPIQLTGGSQLE
REYFLLILSEPFSGLLVAQPIEPWESSMPTQLPQTQPLSTIFTLERQVIQQAFEGIKEAI
AVDDAISEEVLEFWKTRFPQGSASQEKEILTQLLVKQLQQTEAILHPSIPSDLSLGDAVN
RNATTELTPILDTTPTTAPPPDDGLRDKDELLKRVVQELRTPLTSMKTALKLLDAAQLKP
IQRKRYIQLLNTECDRQNSLMTGFLELAQLESEPQPPVMPSVQLADILPGVVSTYQAIAQ
EKGIQLGYTIPSGLPSVSCLETWLRQILINLLHNSLKFTPAGGQVKVQATLQGEYIQLVF
EDTGIGIAAHEIPIIFDIFYRGRSTITQNTGAGLGLTIVQQLLLRCGGSISVTSQVGEGS
SFKVMLLVASSTAPLCQGRK
Download sequence
Identical sequences K9WD29
WP_015181863.1.75295 gi|428310140|ref|YP_007121117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]