SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WD73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WD73
Domain Number 1 Region: 12-373
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.44e-119
Family GABA-aminotransferase-like 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WD73
Sequence length 379
Comment (tr|K9WD73|K9WD73_9CYAN) Putative PLP-dependent enzyme possibly involved in cell wall biogenesis {ECO:0000313|EMBL:AFZ17694.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1837 OC=Microcoleaceae; Microcoleus.
Sequence
MRNIPPIDLKRQYQMIGEQVSAAVQDVLTSGRYIGGPSVESFEQQFAAYMGVSEGIACNS
GTDALYLALRALQIGPGDEVITTPFTFIATAEVITAVGATPVFVDIDAQTFNLDVTQLAA
AITDKTKAIIPVHLFGQPVDMTALMDLAETYGLAVIEDCAQATGAEWAGQKVGSIGHVGC
FSFFPTKNLGACGDGGAVVTNDQNLATSIRQLREHGMVSRYYHEATGINSRLDALQAAIL
KIKLPYLEQWNVARRELAANYHQLLKPVPGVVLPQEQPGSWAVWNQYTLRLTQDNSSGRF
RDEVRRQLQELGVTAMVYYPLPLHLQPVYQKLGYQVGQFPVAETVCHEVLSLPIFPELSF
EEQQQVVYRLKDCLILERV
Download sequence
Identical sequences K9WD73
gi|428310123|ref|YP_007121100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]