SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WD81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WD81
Domain Number 1 Region: 374-662
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.8e-101
Family WD40-repeat 0.0000274
Further Details:      
 
Domain Number 2 Region: 33-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-48
Family Protein kinases, catalytic subunit 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WD81
Sequence length 666
Comment (tr|K9WD81|K9WD81_9CYAN) WD40 repeat-containing protein {ECO:0000313|EMBL:AFZ17487.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1616 OC=Microcoleaceae; Microcoleus.
Sequence
MSYCINPKCPQPNDPANLNNRVCRNCGSELLLQERYQVMRLLSDSSGFGKVYEAYYGAIP
KLLKVLKQKHNDKPRIIELFQQEAAVLSQLNHPGTPRVDPDGYFQFFPKNSTEPVHCIIM
EKIDGLNLKQWMKQQGNHPISEKQAFNWLKQLAEILHLVHQKNYFHRDIKPENIMIRPNG
QLVLIDFGTARELTFTYLADVGGAGSVTKISSAGYTPPEQEKGHAVPQSDFYALGRTFVY
LLTGKQATDSAIYEPLTDTCHWRKLALDVSEPFANLIDKLMAPTAAKRHKNTQEILDEIA
SIYKLPQDAIQPPLGTHLNKDTSIQSYDNLSWVGHKDRAFKKRWLMGGVAALTLMIGGYG
IWQLYQNHLPPASLLVNTIVGDGSYINYLVMTPDGKSLLSSSADKKIKLWDFSTGKEIRT
LIEASIPINYFALSPDWQTLATGGTGNTIAIWDFDSGQKIKTLKGHSSYVNYVVISPDGK
KLASASADHTIKIWDFSTGKELLTLNEHSSYVNYIAITPDGKKLASASADNTIKIWDLSS
GKELLTLTGHSGSVNSLAITPDGRKLASASADNTIKIWDLSSGKELFTLTGHSSPVKPLA
ITPDGNTLVSASADHEIKIWNISTGREIQTIEGHSSSVNSLLITPDGKKLVSASADGTIK
IWRMPN
Download sequence
Identical sequences K9WD81
gi|428309916|ref|YP_007120893.1| WP_015181643.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]