SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDB3
Domain Number 1 Region: 60-346,377-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0052
Further Details:      
 
Domain Number 2 Region: 408-533
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 3 Region: 476-600
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 
Domain Number 4 Region: 603-708
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WDB3
Sequence length 854
Comment (tr|K9WDB3|K9WDB3_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFZ18390.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2598 OC=Microcoleaceae; Microcoleus.
Sequence
MAQDIENGCDESKLRIRLNGCLLIREVLEKLILSIPVKKSKTLINYTFLLLFYVLLPQGR
AFAQLTPDTTLGSESSIITPSVLINNQPADRIDGGALRGANLFHSFLEFNLNDGQRLYFA
SPTGIETIITRVTGANPSNILGTLGVNGSANLFLMNPNGILFGSNARLDIKGSFFATTAS
SMVFADSNSFSATTPQNPSLLTVSVPLGVQFGATPATVQVQESTLQVPLGRTLALVGGEV
RLQGGTVAAPGGRIELGSVADHSFVSLKPINNDWQLGYEGVQNFQDIQLSNRAVVNASGD
GGGDILVWARSLRLGEESRLEALTLGSQRGGKINVNASNSVELTGTGTYLQDIQLFLTGQ
IKPANLRNGLFTLSYGSGAAGDVVINTPSFVARNGAFVATSTLGAGEGGDLTVNASDNVE
LTTSALITGSGLGDSGQAGNLTVNTGRFLVQEYGVLGTSTLGSGRGGELTVNASQSVELL
GNNPIVLGSGTRFLTGLFSTTFGGGDAGDVQVMTPRLSVRDGAAIGASTASLGKGGNLTV
TASEFVEIIGKSGDGSAQSAVAATAEAGSTGQGGNLTVQTGELRLEDEGRLSVRSRGTGD
AGNLEVIADSINLDNQGSIAAATTVAGEGGNIKLQTHSLQLRRNSIINAEAGGSGNGGNI
TIDTDILVALKNSSITANAFQGTGGNITINTQGLFVAPTSKITASSTLGISGVVDINTEV
NSVEASLPPLEEDFVSSEQVIADSCLGRPNAQGRSFTVTGTGGLPATPDGAFTTSYPITD
VQQIAENSTTGWRVSPEAIAEHSDRRIVLPLQEAQGMFITADGRVVLGTIPQLAALAQAE
DLICYFQTQSASRK
Download sequence
Identical sequences K9WDB3
gi|428310819|ref|YP_007121796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]