SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDC4
Domain Number 1 Region: 280-533
Classification Level Classification E-value
Superfamily TPR-like 2.31e-61
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 
Domain Number 2 Region: 3-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-58
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 3 Region: 512-606
Classification Level Classification E-value
Superfamily TPR-like 7.05e-29
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WDC4
Sequence length 606
Comment (tr|K9WDC4|K9WDC4_9CYAN) Serine/threonine protein kinase {ECO:0000313|EMBL:AFZ17749.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1894 OC=Microcoleaceae; Microcoleus.
Sequence
MEGQRLGGRYQIISQLGRGGYGITFLAEDWQLPGNPRCVVKQLKPEATDAKNLKVAAQLF
NSEAQVLYRLGNHPQIPKLLAHFEENQEFYLVQEFIEGHNLTQEFPKGKPLNESYVIAIL
RDILEILAFVHQQNVIHRDLKPDNIRRNKDGKIVLIDFGLVKQLSTQQTDSQNSVTLTVN
MGTRGYMPSEQALGKSKFSSDIYALGMIAIQALTGIIPRKLSEDANGEVIWRDKVQVSTK
LAEILDKMVRYDFRQRYPSATEALEALKEAGLITSSLMPNSSYNSPQSLFNKAHILCELK
RYSEAIAYYEDAILIQPNFYQAWYERGKALYQLERYEDAIASYDQVIQFQTDDAEVWFER
TQALYRLQSYSEVMMGLDKALQIRPDYAEAWVMRGVVLRNLQRDEEAIACYNKAIEFKPD
YAVAWYNRGVLLASWQRYEEAFTAFDQVIQLQPNNAVAWYNRGAALGNLQRYEDAIVSCN
QAIAFNPNYVQAWFQRGMALGELQRYEEAITAYDKVIQLQPDYGEAWFQRGFALYNLQRY
EDAIASYDQAIEFNPLDAEAWGNRGGVLLKLQRYEEAIASFDKAIQIQPNFPMAIYNRAQ
ALSQLG
Download sequence
Identical sequences K9WDC4
gi|428310178|ref|YP_007121155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]