SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDE5
Domain Number 1 Region: 34-414
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-69
Family GABA-aminotransferase-like 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WDE5
Sequence length 426
Comment (tr|K9WDE5|K9WDE5_9CYAN) 7-keto-8-aminopelargonate synthetase-like enzyme {ECO:0000313|EMBL:AFZ17826.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1977 OC=Microcoleaceae; Microcoleus.
Sequence
MQVVKEYVQRWYESDLDPDEYICHHKRGNLVEIEEATTGKRRTVLTFCTNDVLGLVQEDA
VKQAAIDAILQYGTSNSSCSVLSGRIDLHRQLEQEISEFKHLPHTQLFINAWMAMQALMD
AFCHLAIPVPGFQNTRETLILTDVLNHGCIVSAVANAGTRSGKLFGHSPRVRVRAYRHCD
VEDLARKLRRYARPDERIMVISDAVFSMDGDIAPLPDMLDVMQHYDGSVLVMDEAHASGA
IGATGRGIYEHFGILPQNAIERGIVPLIMSTFSKFAASAGAAISSHVAELIPLLNVSPTS
IGTISLSPPLAAAALESIRQVRQHPERVKNLQENTHYLRSSLIEQGFTAIGETNVVPVLL
PPELNPKVFGRLMLEKHGIWVSPIWFIAKPRLRITVNALHTQEEMDRLVAAMVATRDLLY
QPMISA
Download sequence
Identical sequences K9WDE5
gi|428310255|ref|YP_007121232.1| WP_015181978.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]