SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9WDF0
Domain Number - Region: 138-204
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.00916
Family Vanillyl-alcohol oxidase-like 0.036
Further Details:      
 
Domain Number - Region: 173-384
Classification Level Classification E-value
Superfamily TPR-like 0.0455
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WDF0
Sequence length 439
Comment (tr|K9WDF0|K9WDF0_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ18425.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2637 OC=Microcoleaceae; Microcoleus.
Sequence
MAGFNLPFKFPFRKAQNISGIDPSLKSKQPVILKPSIPSPPASKSFAELEREVEAQYHAT
YPHKQPVPQKAKRGVLSKIIWMGILLGIPVGVVWVANLPYPVIRRPVAQKAPILLLPSYM
NMEANYRQAITSVEQAEQLIENPTSPADLHRGEQKVKEAQKNLDALPVWFLNDWPEYRAW
WYDWRFSIYGFNAARTKVGQLDAKVFQEKNAQTSLTQSEQDILKAKQQYQQASTPIDKQA
AISSWRSAINQLEQVPSITLAGKTAKAKLEDYQRDVQEIVGLAAGNERVSTLITAARQFS
WEAAKAGQNPPHTVAEWEQVENLWEQAIAQLQQIRSDDLTGYAEAQKLLAQYNRNLGQVK
IRQQAEQASVEALQQSQSKIERLLASIPADAQSVNRNYTISELQGIIYELEKVQNGTTAY
LKAQSLLLSAQNKLKQLQP
Download sequence
Identical sequences K9WDF0
gi|428310854|ref|YP_007121831.1| WP_015182574.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]