SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDI8
Domain Number 1 Region: 143-175,216-312
Classification Level Classification E-value
Superfamily TPR-like 0.0000000194
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WDI8
Sequence length 585
Comment (tr|K9WDI8|K9WDI8_9CYAN) Peptidase family M48 {ECO:0000313|EMBL:AFZ18465.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2678 OC=Microcoleaceae; Microcoleus.
Sequence
MKTLWNTLLISIGLLLPNSTVVVLAQSLSKTIEEPVAIASTGIVVAEKLSPAQPPPTLVV
PVLETTPETRPAGTAVESSGESPETPVIPNTTPNSTPVAPTAEETPASTQTESSEDKSST
EESADAQAPELSPEELARQEKLIQADQLFMNGQVSAAQKLYRAAKEPFPTGELAEETAQP
EPIYDAAQLPAAGAVYWRMSGEGLEQKLKTKIFVPLESLVERFPQFIPGHLRYAQALKEY
EQSEKALQVLERASSLYPKEPELLKATITAMGEQKKWLEASLTARQFALLYPDHPQSNEF
SQLADENLERYRNYMRRELRGNAIANAITGALGLVFTGNLFGPISAIDSTVMLLRGESAV
GESVANQAKRQLPLMEDEEVLNYVREVGNKLTLVAGRKDFEYEFHVVMDDRLNAFALPGG
KVFVNAGTILKTRSEAELAGLLAHELAHAVLSHGFQLVTQGNLIANITQYIPLGGTAANL
IVLDYSRDMERQADALGTRILAASGYAADGLHNLMGTLEKEERDRPLFAWLSTHPDTRER
TRNIETLIQRNGYNRYTYEGVSRHVEIQKRVAQLLKEYKEREKKN
Download sequence
Identical sequences K9WDI8
WP_015182614.1.75295 gi|428310894|ref|YP_007121871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]