SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDS6
Domain Number 1 Region: 69-238,267-296
Classification Level Classification E-value
Superfamily TPR-like 2.06e-20
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 
Domain Number 2 Region: 326-451
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000721
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WDS6
Sequence length 870
Comment (tr|K9WDS6|K9WDS6_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ18388.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2595 OC=Microcoleaceae; Microcoleus.
Sequence
MGLSYPGTLPKKFQMWQHWHRFSLLFLASLVFCCVFHFGSLRQVAHSATPQRQFTASIPS
QEPYSQVVQQGVERYQAGKFTEAIALWQKVLSQITSPKERAALYSNLALAYRQIGQSGKA
IAHWQQAIQIYQHQDDQAARSQLPKLLTEQAQAYNELGQNRQAIKILQSALERAKQIPDL
QTQAATLGALANAYWAVGNYEKALFSHQASLKIARQLNTPDYIASSLNNLGNLYISRSER
YRYQANVARVEGDEPEKIRLMQLAEQEMTAAQSAFNESLRETQAVGGITYVKTLLNLNRL
LEQLPSPDWAAIARNREKLLVRVETLPDSRDKAYILINLAQHFSDPEPGRNALDASLVLK
KAVSIARNIGDQRAESFALGSLGQIYKSAGQTSEAMELTQQAQWVAMQANAPDSAYRWQW
QTGRLLKAGGKTKEAIASYEQAIATLQSIRNNLLAINTNLQFDFRDSVEPVYRELMQLLL
EPSMLRNLEQRKTNLSKVIDTLELLKLAELQNYFGDECVEVAQADAKSEASLLDANSAII
YSVILHDRTEMILRLPDGLLTSYSVSLNQEQMQQEIDQLRKLLEKRSTNEYLLAAQKIYN
ALIRPLEADLAAAKVKTLIFIQDAMLRQVPMAALHNGQQFLIENYAIATTPSLALTTRTR
APEHYSSALIMGLTVERPPFIALTNVRTEVASVQKLLGGTQLLDQDFTLANLQEQLQNKS
YPVVHIATHGKFGVDAASTFLLTFDSRMTLEQFDEVLREAKLSQKRSQRNQQPVELLTLS
ACQTAAGDNRAALGIAGVAVRAGVRSALASLWNINDEATVPLIEEFYTQLEQPYVTKAKA
LQTAQLKMINHLEYSHPAVWSPFILIGNWL
Download sequence
Identical sequences K9WDS6
WP_015182537.1.75295 gi|428310817|ref|YP_007121794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]