SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WDU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDU5
Domain Number 1 Region: 26-169,207-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-51
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 471-525,557-586
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000282
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Weak hits

Sequence:  K9WDU5
Domain Number - Region: 380-461
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000286
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WDU5
Sequence length 849
Comment (tr|K9WDU5|K9WDU5_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFZ18408.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2616 OC=Microcoleaceae; Microcoleus.
Sequence
MSHSLNKDCHYRNHLLTSAIILSSLCLNYPLQAQIVPDNTLLFNSLTTQSGNTSIITGGT
PAGSNLFHSFSQFSVPTGGTAYFNNSSAIQNIFSRVTGSSISNIDGLIRANDANLFLLNP
NGIIFGPNASLDIGGSFLGTTANRIIFADNTQFSTTNPQTPSLLMVNVPVGLGFGSNQAA
IRVQGTGQRLIEDPLFPLLDRSSIVTGLRVSPGKTLALVGGDVTLDGALLTAEGGRIELG
SVGSGIVSLSPTTQGWALGYQNVQSFQNIQLLSQALVDASEATTGNGGGSIHLQGANVAL
TDGSFILIQSQGDQPGGSINVNASESLEISGSSPDGLLPSRLVNQTVGAGQGGDIELSTQ
RLIIRDGGYVDNRTLGSGNGGEVRVNATESVQVSGASAFNPSLLSFLNSETYGSGRAGDL
SVSTGQLRVLDGGAIVSATFSTGSTGTVRLNATQSIEVAGAQTSRLVASTVGSASGNEGN
AESVIINTRKLVVRDGGRVDSSTLAYGNAGSIIVNASESVEVSGKAPGFVNPSLIISSAN
IVDPLTQAFFGLPPVPTGDSGNVTINTPHLSVTDGAQVTVRNDGTGKAGTLIINADSILL
DNQGGITASTNAGESAQEGSITLNVRDSLQMRHNSIISAEARGDQRGGNIIINAGAIAAV
PEENSDITASAPQGTGGRITINTQGIFGTQVRDQQTPESDIIAVGKTPEFNGIVQVNTPE
INVQDALNQLNTNFFSTEQAIASSCFARRNVEQGSFTSTGTGGLPTTPYDAQGGRYPVTQ
VQALPHPATPQTSSPAPKTPSTWKLGDPIQEAQGISVTPDGRILVGTHPQLAALKDPQRL
ICHPTQVEE
Download sequence
Identical sequences K9WDU5
WP_015182557.1.75295 gi|428310837|ref|YP_007121814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]