SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WG72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9WG72
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0157
Family LIM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WG72
Sequence length 60
Comment (tr|K9WG72|K9WG72_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ18517.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_2733 OC=Microcoleaceae; Microcoleus.
Sequence
MLVNTCPCCGSVLLRHARRKGVYWYCTSCHEEMVPLMMGQLPMCSEPRKKRSQILQSVNS
Download sequence
Identical sequences K9WG72
WP_015182666.1.75295 gi|428310946|ref|YP_007121923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]