SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WGL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WGL8
Domain Number 1 Region: 1080-1270
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.29e-54
Family Adenylyl and guanylyl cyclase catalytic domain 0.000000184
Further Details:      
 
Domain Number 2 Region: 696-860
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-48
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 3 Region: 919-1060
Classification Level Classification E-value
Superfamily CheY-like 3.84e-38
Family CheY-related 0.00068
Further Details:      
 
Domain Number 4 Region: 48-171
Classification Level Classification E-value
Superfamily CheY-like 2.7e-29
Family CheY-related 0.0015
Further Details:      
 
Domain Number 5 Region: 207-260,311-406
Classification Level Classification E-value
Superfamily GAF domain-like 2.52e-22
Family GAF domain 0.0015
Further Details:      
 
Domain Number 6 Region: 418-472,501-638
Classification Level Classification E-value
Superfamily GAF domain-like 1.4e-21
Family GAF domain 0.013
Further Details:      
 
Domain Number 7 Region: 626-708
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.55e-17
Family Homodimeric domain of signal transducing histidine kinase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WGL8
Sequence length 1280
Comment (tr|K9WGL8|K9WGL8_9CYAN) Signal transduction histidine kinase {ECO:0000313|EMBL:AFZ19343.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3619 OC=Microcoleaceae; Microcoleus.
Sequence
MDHFSPDRPTNEPPLSREESVNSVQTFFTRQALATGERCMRSQETIRPKLLVVDDEPDNL
DLLYRTFHREYKVLRADNGPAALEILAKEGDIAVIISDQRMPLMSGTEFLSLTATRYPDI
IRIILTGYTDVEDLVEAINAGKVFKFVTKPWNSDDLKAVVRQAMDTHNVLKVRTRELCRA
LRRESLLNTVTNTIRNAQFGQEGDSPLQQILQRIVESVGHLLEVDICLLRPFQDGRLVDE
WFVYQKDQGSLRSSTEAGLNGSASPTEIAANSPEPVTTDSEIGAREKAMGDSALLASPHL
PVSSSSSSYPSLLEQTVWETREVEVINDVLTDERFLSEGEEIRQRAIAYQQTNIRSTLVV
PLISQQELVAVLALHQCEQPYYWQDDEIQLVVMVADQAALALSQARAYEQVRALATQQAL
VNTITNAIRSTLDPQEIFTAITQQLGQAIKVDGCTLSLWREEDEFVQCVGLYDGKSAQVV
ESEDTENFNTAFINQFSNSSSVTHQLPQSLVPISGNPVLQQLVRTQQPVAIDDLAANPEM
KGFDLPFRKPARALLVVPLLADSASSNASVSDARTTPRLPGQPSGKIIGSITLRHTYRPR
HWLPSEINLAQAVAAQAAIAVQQSRLYQKTRQQAERLMELDRQKTEFFQNISHEFRTPLT
LMIGPLESVIERKQDLPYEQCAIALRNSRRLLRLVNQLLDLHRLDAGRMQASFRPCNLVQ
FVSQIVEAFRPYCDKKNIRLSTQLTRCTSVYVDLEKFDKVLYNLLSNAMKFTEAGGNITI
KVESAGDHVRLQISDTGIGIKKEQVPHLFERFRQAEGSVNRSYEGSGLGLALVKELVELH
GGQISVESVYSEGTTFTVWLQTGTSHLPVEQVLEVPTEMQVSRASVELADLEIELPVEEE
EQGTGEPQIKVAGVPASPPSQILVVDDNSDLRAYVSRILRQEGYQIRIARNGAEGFEVAQ
EYRPQLIVADLMMPEVSGLDMIRMIRDTEELKGTPIILLTAKADEATRIEGTEQGADAYL
SKPFNDRELLAEVRNLLALKANEQRVLELNTYLTESVLRRFLPPAMVQRAAKGELELDLS
PEQTLITTLFSDIVGFTQLSNTLRSRRVAELLNEYLAAMTQAVFDNGGTVDKFMGDGILA
IFGAPEVLSPKEQVRRAVATARQMLRSLEQLNQRWEEQGIVGKDGPPPVRFRCGIHQGTA
VVGMFGGKERSDYTAIGPSVNIASRLQEAAEPNSILVSAQVADWLDDHEITKFRPLMLKG
VDETVLTFSVKPMTNDSDKM
Download sequence
Identical sequences K9WGL8
gi|428311772|ref|YP_007122749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]