SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WGQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WGQ2
Domain Number 1 Region: 64-303
Classification Level Classification E-value
Superfamily TPR-like 1.82e-41
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 329-493
Classification Level Classification E-value
Superfamily TPR-like 5.82e-26
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WGQ2
Sequence length 496
Comment (tr|K9WGQ2|K9WGQ2_9CYAN) TPR repeat-containing protein {ECO:0000313|EMBL:AFZ18964.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3225 OC=Microcoleaceae; Microcoleus.
Sequence
MSSDKDRQNEIMVLSGNGRVSRNCSSLTEGLDLASQHQGVEGKSLEPVELPMKPAITGVV
TLEASESFKQGLNKFHRGDYRGAIQDFNQALRFNADFAEVYYYRGMSRYKKGDYLGAIND
YSQVLRVNPHNAEAYSERGFVRAVLADRWGAMQDYNQALQIDAKHIKTYLNRIPLRVELA
DYQEAIADCNAALNINPNLPKAYLYRGMAHFELEDYPNAMEDYNQALNINPNLAEGYFNR
GLNRIGLGDYQEAIADFNQALKLNPNYTQAYLNRGYTRLQLGDNWGSLEDFDQALHLDPV
SAKAFFSQMAPAFSQELGIVEDENQQLIQGLMLQGNLRYDSGDYHAALNAFNQVLNLDPN
YTEAYNRRSTVRSALRDYEGALEDLETAKNLSLSHQPSLQPPPVVPVGQTAKDYYHQGVE
KLQIGDFQGAIADFNQVLQMNGNDATTLTCRGFAYSRVGDKEKAIEDLQTAAKLFHEQGD
VKSSQEIVETIKKLQP
Download sequence
Identical sequences K9WGQ2
gi|428311393|ref|YP_007122370.1| WP_015183108.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]