SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WH07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WH07
Domain Number 1 Region: 277-450
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-43
Family Histidine kinase 0.00096
Further Details:      
 
Domain Number 2 Region: 586-697
Classification Level Classification E-value
Superfamily CheY-like 2.42e-21
Family CheY-related 0.0029
Further Details:      
 
Domain Number 3 Region: 203-289
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.28e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 4 Region: 459-585
Classification Level Classification E-value
Superfamily CheY-like 2.28e-17
Family CheY-related 0.0034
Further Details:      
 
Domain Number 5 Region: 32-134
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000747
Family Histidine kinase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WH07
Sequence length 720
Comment (tr|K9WH07|K9WH07_9CYAN) Signal transduction histidine kinase {ECO:0000313|EMBL:AFZ19690.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3985 OC=Microcoleaceae; Microcoleus.
Sequence
MAISATIITIEIRFEQDVVMTRQRARLIAELLGFDAQDQTRIATAVSEIARNAFQYAQGG
RVEFRVEGESPQSLLICICDKGAGIANLNSILEGRYTSATGMGLGIIGSKRLMEWFEIES
SSSHGTTVQMGKPLPKRALVVNGPRLAQIADELVQRSPSNPLEEIQQQNQELLRALAELQ
KREEALTQLNRELEDTNRGVVALYAELDEKADSLKRANELKTRFLSNMSHEFRTPLNSVI
SLSRMLLDRMDGELTPDQEKQVTFIRKAAEGLSELVNDLLDLAKVEAGKIVVQPDNFEVS
ELFGTLRGMLRPLLAHNSSIALVFEEPRDIPTLYTDEGKVAQILRNFISNALKFTPTGEV
RVSAVRVGNTITFSVADTGIGIAAEDTERIFEEFVQVDSPLQRQVKGTGLGLPLSRKLAE
LLGGNVWVTGTIGVGSTFFASIPLVYSGSNQESPLPPVSWKLDPQRLPILVVEDNAETLF
TYEKYFQGSIYQPFLARTLDEAEQALTLFTPTAIMLDILLEEQHTWGFIAELKGNQATQE
IPILVVTVIDNEKQVRALGANAFLVKPVDRWSLLNQINTLIKRNTPQKLLLIDDDPASQY
VLKQLLSDTDLNISEAFDGREGIDLAQIEKPDCIILDLSLPEMSGDKVLSLLKSDSKTND
IPVIINTSQSLETEEQKNLAQNTVAILSKETASQEIAIARVREALVKAGIALKACERGYV
Download sequence
Identical sequences K9WH07
WP_015183827.1.75295 gi|428312119|ref|YP_007123096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]