SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WH33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WH33
Domain Number 1 Region: 476-641
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-37
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 283-410
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-20
Family Heme-binding PAS domain 0.018
Further Details:      
 
Domain Number 3 Region: 404-478
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000179
Family Homodimeric domain of signal transducing histidine kinase 0.0064
Further Details:      
 
Weak hits

Sequence:  K9WH33
Domain Number - Region: 225-272
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0228
Family Rubredoxin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WH33
Sequence length 647
Comment (tr|K9WH33|K9WH33_9CYAN) PAS domain S-box {ECO:0000313|EMBL:AFZ19513.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3795 OC=Microcoleaceae; Microcoleus.
Sequence
MSQKREGKTWGDGRQANRNRLGHRFFGRVRTVASALLPLTSRLAASGHATVAKRLRSRSR
SVPEGSVPEGSVPKGSMVEEHTGFGMATNTLAADYQAWRQQFLWKRLRIALWVGMSFIFT
MVIFFFWATVEDLAEQKPFKSSYFISSAVVAFCLITCYWLHKTPLGRRYPGAMFLAFSWS
LTIVTQTTVALYRVPILLKPLWMIVFIIQATLIPVRWRLHVTSQFIAYVCYWVVNAALSL
SAYDRVLDYVAGTLPLFWVCLVCDLSVYLYERLQQAEFSARRELELAYQRVEAAEAKYRS
IFENALEGIFQSSPQGGYITANPALARIYGFNSPEELIESLTDIQHQLFVDPNCYAECMK
IMQHNGMVSEFEAQIYRKDGNVIWININAREVRDEQNILLYYEGLVEDITDRKLSEEALR
VFFHAVSHDLRNPVTGTLMVLKNLEQQSGDKIELPRRILERMIQSGDRQLNLINTLLEAQ
VNEVKGMVIHCQPLELYPFIQEVVADLEPILTKNQATVINLIPADLPQINADSTQLWRVF
ENLISNALNHNPPGLTLKLQAEIEGTLVCCIIQDNGVGMAQKECEHLFDLYRRGSSIKRS
LGFGLGLYICRQIITAHGGKIGAVSSPGTGARFWFTLPITSSSHQTC
Download sequence
Identical sequences K9WH33
gi|428311942|ref|YP_007122919.1| WP_015183654.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]