SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WH85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WH85
Domain Number 1 Region: 275-432
Classification Level Classification E-value
Superfamily TPR-like 1.14e-24
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 12-159
Classification Level Classification E-value
Superfamily TPR-like 2.66e-23
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 3 Region: 134-268
Classification Level Classification E-value
Superfamily TPR-like 3.15e-17
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 4 Region: 419-604
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000228
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WH85
Sequence length 1092
Comment (tr|K9WH85|K9WH85_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ19161.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3432 OC=Microcoleaceae; Microcoleus.
Sequence
MKILPGTLQGLSLGYRSLGEFDKALDFAKQSLTYVQTLKKPNLEAEALINLGELYTDMRD
LPNAIESTQQALSIARQIKDPKTEADALQQLSQSYTKQGKHPQAIELAHQALQIARRLGN
TDIEQRTLGELQDIYDNQGNYQKALELAQQSLALLQQTKKDDGLALQYLSHSYQNVGDTQ
KAIEVANQALAKFRQQQNPYFEGQALATLSQAYNAQGKYEQGIEVGQQSLAIAQKLRSFL
GEAHAAESLSDAYQKLGDYQKVISVAEPGLVSARKYKNREREARLLMNLGDAYQVVGNYT
KGKEFIEQSLVIARELKNPGLEAQALSYLGNLYNNSNDFQKALELNQQSLKIATELKSPS
LQSIPQFNLGHIYRNLGNYQKSNEFYQQALTTMRQLKNRQGEGNALLNLASLAEPQQTIE
FAQQALTIFQEIKVPGMEVFATRMLSVGYAALGNDAKAMESAQAFLAFTRKTQNPTWEKQ
ALNLLGQLHRKFGRNEQAIAAYQAALAISTPTEVAGGKAYSLYGLARIYRDLNQPNIAIN
YYKQSVNQIEEVRRNIQGLPPELQKSFLEATVDFDQVKVSDIYRQLAELLLSQGRDKEAL
YVQELLRGQEIRDFISAGNRTGDKPQIPLTPTEAKIPAPNQSIVALGRQISECEQTNSQQ
CSQLKDQQTALITANVQELQKIDKEIRENRQKDDIFFDPQNFGKIREIVNAQPNTVMIYP
LVLEKELQLQLYATGDVIKTVKVPVSREELGNTVLEFRKLMEECEKRTCGSADIPKAQAV
SQKLYNWLIQPIEGELKANSVKHLVFALDRVTRYMPMSALFDGKQYLMENYTIAIAPSAA
LADTKDKLPIGTQNTSVLAMGLSDRVPGFDPLLNVPIELDGIVRSQTNDTQGIYPGEKYL
NRTFDFRTLRDNLKGHKILHLATHGVFDPTSSNKSYILLGTGIPLTPDMISALTGLSDIH
LVVLSACQTALGGSQQDGVEINALAYYFMNNAAKAVMASLWLVNDGSTSLLMQQFYKNLA
TGTSEKPMTKAEALRQAQLSLLQGKLTAKDAPQRGLEVVAKPEVETSADNSSSSNLSHPY
YWAPFILIGNGL
Download sequence
Identical sequences K9WH85
WP_015183303.1.75295 gi|428311590|ref|YP_007122567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]