SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WHA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WHA2
Domain Number 1 Region: 11-164
Classification Level Classification E-value
Superfamily CheY-like 5.27e-43
Family CheY-related 0.00027
Further Details:      
 
Domain Number 2 Region: 340-516
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-38
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 3 Region: 536-653
Classification Level Classification E-value
Superfamily CheY-like 2.85e-27
Family CheY-related 0.0028
Further Details:      
 
Domain Number 4 Region: 162-272
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-21
Family Heme-binding PAS domain 0.045
Further Details:      
 
Domain Number 5 Region: 280-346
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000863
Family Homodimeric domain of signal transducing histidine kinase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WHA2
Sequence length 655
Comment (tr|K9WHA2|K9WHA2_9CYAN) PAS/PAC sensor hybrid histidine kinase {ECO:0000313|EMBL:AFZ19144.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3415 OC=Microcoleaceae; Microcoleus.
Sequence
MSADPTNQSVILIVDDTPTNLEMLFDFLGLAGFKVLIAEDGESAIERAEYAPPDLILLDV
LMPEMDGFETCRRLKANELTKDIPVIFMTALSETTDKVKGLNLGAVDYITKPLQHEEVLA
RVQLQLRLRNLMKTLQEQNQRLEKEIQQRHLSEQKIREQAALLDITTDAILVQDLDNQIL
FWNKGAEQVYGWTAEEAIGKHALKLLYREALCDIENPSQLLAECGSWQGELRHVTKQGKE
IVVATRWTLVCDEQGVPTSILTVNTDVTEKKQLEAQFLRAQRMESLGTLASGIAHDLNNA
LTPIMMTVQLLETKLHDEQSQEWLSIMETNVRRGADLVRQVLLFSRGLEGRRSTLKVEKL
ISEIEQIVKQTFSRAIEIHTDLPAQNLWTIRGEATQLHQVLMNLCVNARDAMSEGGILKI
SAANLWVDESYARINLDAKVGPYVVITVTDTGSGISREIIDKIFEPFFTTKDLGKGTGLG
LSTAIGIIKSHGGFVNVDSQVGKGTEFKVYLPVTQSRETDGIQTDHHELLAGHGELILLV
DDEESIREVSKTLLEANGYKVLVASDGIEALALYTEHKEEIRAVLIDMMMPSMDGPTTIR
VLQKMNPQVKIIGVSGLVSNHKMIELVGSCVKTFLPKPYTSNELLKNLQTVLSTH
Download sequence
Identical sequences K9WHA2
WP_015183287.1.75295 gi|428311573|ref|YP_007122550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]