SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WHF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WHF7
Domain Number 1 Region: 698-848
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-34
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 374-485
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-23
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 3 Region: 251-362
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-19
Family Heme-binding PAS domain 0.0041
Further Details:      
 
Domain Number 4 Region: 614-697
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.65e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 
Domain Number 5 Region: 473-595
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000436
Family Flavin-binding PAS domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WHF7
Sequence length 851
Comment (tr|K9WHF7|K9WHF7_9CYAN) PAS domain S-box {ECO:0000313|EMBL:AFZ19850.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4148 OC=Microcoleaceae; Microcoleus.
Sequence
MDASKFSSTRLKFPSDVWVRRRGAFIISIPVICLLASILVIAALRARTIAVRQQEQQSQK
TVTDTSRLLKELIEAETGVRGYVITRRPEFLSPYLKAKALLPQSVDTLYAQVENYPARRQ
QFQEILSLARQQFQLLEQTLETSDRQGATAGTSTLITERLQESRLNMDELRQAISEFYEQ
EKRWQNDRQVQAFRWARVTTIVQWTCLAVGLLGSGAALCLFNQLDQDRRQQASRLRTNNL
YLQAIFDHVVDGIIIVNSRGYIQSANSATGEIFGYEPSELQGVHLQRLMAELFAEDSGQA
MKSLVGKNHDKLRLQQETVGRQKSGQIFPMEFALSEMQLDNEHLFIVIVRDITERKQSQD
ILLKQAQLLNLANDTIIVRDLNDTITYWNQGAQRLYGFSPAEAVGQCIHSLLQTEVPQPL
EEIEEALFQQGYWSGELMHSRRDGSRVFVKSGWTLQRDETGMPLAFLEINQDITERKQAE
AALRKSEELYRTLVKNFPNGAVFLFDQQMRYSIAEGTGLANINLNSELLTGKTIWETLPL
ETAQILEPIYREALQGKRTVTEIPFSDRFYCVHVLPVINEDGEILLGMTMTQDITESKKA
QQALRARADELARLTTVLAQTTTNLEKRNAELDQFAYIVSHDLKAPLRAIANLAQWLEED
LADSLTAETRHQMDLLQGRVHRMEALINGLLQYSRVGRFRTELELVDMEILLAEVIDSLA
PPPEFTITVMPDMPTLWIERVPLEQVFANLIGNGIKHHHRKDGKIVISAQEHTDCYEFAI
ADNGPGIAPEFHEKVFIMFQTLEPRDKVESTGVGLAIVKKIIEDKGGTIVLESAPSQGAT
FRFTWPKQPMA
Download sequence
Identical sequences K9WHF7
gi|428312279|ref|YP_007123256.1| WP_015183986.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]