SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WHP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WHP5
Domain Number 1 Region: 484-531,581-705
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-39
Family GAF domain 0.0018
Further Details:      
 
Domain Number 2 Region: 794-957
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-35
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 381-476
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000898
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 4 Region: 721-796
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000143
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WHP5
Sequence length 959
Comment (tr|K9WHP5|K9WHP5_9CYAN) PAS domain S-box {ECO:0000313|EMBL:AFZ19037.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3303 OC=Microcoleaceae; Microcoleus.
Sequence
MNRQNLMPLSQRSIWRYIAVVGAIAVAYYGGAYLTVSSLGLGLEASPLWPSAGIALAGLL
LAGERVWPGVALGSFFWCQSQVSLTMAFALAFSITLQAFLGAEVFRWLKFRPSLKRRQDV
LHLVVWGAWGSTLINASLSTLIGCLGGTVEPEQWQENWWTLWVGDGMGILVVTPLLLMGR
HWLGNVRWMIAQILQGKPWEWGKKWWFHRRLRVVPHSPALDKPSQGEKNSTLAEAVICFT
LLFTLCWLVFALKSAVDLAQYPLEYLPFPFVVWAAIRFTQRGAVAATLIVCTIAIWGAMQ
GVGPFVANTSIKQTVLFLQGFMGVVSITALVLAAAESERARAVDLLKEREASLANAQRLA
QLGNWDFYETCNNSCLPQQKLQWSDELYRLFGFSPKAFEPTWETLFQVVHPADRDRVGQA
IRGALRENQPYCLDYRIVRPDGSERMVCEQSEIYGGGIRGTVQDITERQRVEAQLRAAAE
HVSEAAERQRLLGEMALRIRRSLHLDQILNTTVAEVREFLKADRVFIGQIDGISQPLNVS
QLLASHRSSSQNVAQVDSSEENLPFKNALDKQPSNLQTFKPSTLLKGLIIAESVEPCYPS
LRSMVIEDEATIQEWRSRFSQGHVIAIEDTKTIPCSCHIAAYHAEYQVGAILAVPIWVGD
NLYGALVVNQCSQSRHWQSWEIEWLTSLATQVAIAIQQAELYRQITDLAAHLESQVEERT
QELTAKMTELQELNQLKDVFLQAVSHDLRTSLLGMSMVLKHLYQSAGDGVTLSRPILERM
ITSNERQLNLINSLLEDHFNEERQLELHRQPIQLTQLCQDLITGYSPILAQNQATLTPQL
PENCPMIDADPIQVRRVLENLLTNALKHNPPGLNLTLQLQVEDQKIRCTLQDDGLGMSQE
QQNSLFKLYIRGLHTKHLTGIGLGLYQCRQIINAHGGEIGIISSSNAGSTFWFTLPLAD
Download sequence
Identical sequences K9WHP5
gi|428311466|ref|YP_007122443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]