SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WHY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WHY5
Domain Number 1 Region: 243-424
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-41
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 445-582
Classification Level Classification E-value
Superfamily CheY-like 4.13e-34
Family CheY-related 0.0089
Further Details:      
 
Domain Number 3 Region: 29-163
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-24
Family GAF domain 0.046
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.1e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WHY5
Sequence length 655
Comment (tr|K9WHY5|K9WHY5_9CYAN) Signal transduction histidine kinase {ECO:0000313|EMBL:AFZ20020.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4322 OC=Microcoleaceae; Microcoleus.
Sequence
MANQQLISQKETERLNALRRYEILDTPPDGAFDRITSIAARLFKVPIAIVSLVDSDRIWF
KSHHGLDVEQIERTPGLCASAILSDEIYAITDASKDLRSLTNPLVVGEMGLRFYAAAPLR
THDGHNLGTLCVIDQKSRSISSEEMSILTDLAAVIMDEIELRLGAKKVDQLNIELAKAKE
AAEVANVAKSTFIANMSHELRSPLNVILGFTQLMTKSSTLAPEQRENLSIIARSGEHLLT
LINQVLDLSKIEAGRTTLNETNFDLHRLLDDLEDMFQLKADERHLQLVFERNSDIPQYVR
TDEVKLRQILINLLNNAIKFTQEGGVCLRVKRQTSNDETEENISQFKLNFEIEDTGYGIC
QDDLEAIFEAFVQSQTGKQAQEGTGLGLPIARKFVQLMDGEITVSSEVGHGTIFNFDISI
SPADTANPEPKLATRQVIALEPNQPRYRILIVDDKWSNRHLLMKLLSPLGFELKEASNGK
EAIEVWDTWEPHLIWMDMRMPILDGYEATKQIKGISKGQATAIIALTASTLEEDRAIVLS
AGCDGFVRKPFREADIWDAMNKHIGVRYIYDEPANELHSTPLDFDALTPTTLNALPASWI
AELHQAVAAADSELAFSLIEQLEAKDTTLAKVLSKLVSDFEFDRIEGWIAQILNQ
Download sequence
Identical sequences K9WHY5
gi|428312449|ref|YP_007123426.1| WP_015184156.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]