SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WIH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WIH2
Domain Number 1 Region: 77-427
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.24e-75
Family Extended AAA-ATPase domain 0.00000000767
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WIH2
Sequence length 446
Comment (tr|K9WIH2|K9WIH2_9CYAN) ATP-dependent Clp protease ATP-binding subunit ClpX {ECO:0000256|HAMAP-Rule:MF_00175, ECO:0000256|SAAS:SAAS01014625} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4305 OC=Microcoleaceae; Microcoleus.
Sequence
MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELLDSSGPAPQPVPP
KEPPQKRRARASGLSLNQIPKPRELKKYLDEHVIGQDDAKKVLSVAVYNHYKRLSFIQSK
GNGKAGLEDVVELQKSNILLMGPTGCGKTLLAQTLASVLDVPFAVADATTLTEAGYVGED
VENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEG
TVANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKVVEQRIGKRSIGFIQPGEGQS
KEKRTADVLRHLEPDDLVKFGMIPEFIGRVPVVAVVDPLDEEALMEILTEPRNALVKQYQ
KLLKMDSVQLEFKPDAIRAIAQEAYRRKTGARALRGIVEELMLDVMYELPSRKDVTRCMI
TREMVEKRSTAELLVHPSSLPKPESA
Download sequence
Identical sequences K9WIH2
WP_015184139.1.75295 gi|428312432|ref|YP_007123409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]