SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WIN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WIN9
Domain Number 1 Region: 3-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-49
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 1586-1767
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-40
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 3 Region: 1794-1930
Classification Level Classification E-value
Superfamily CheY-like 4.98e-35
Family CheY-related 0.0039
Further Details:      
 
Domain Number 4 Region: 1335-1513
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-27
Family GAF domain 0.0063
Further Details:      
 
Domain Number 5 Region: 1518-1598
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.89e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 6 Region: 314-588
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.66e-17
Family Extended AAA-ATPase domain 0.085
Further Details:      
 
Weak hits

Sequence:  K9WIN9
Domain Number - Region: 799-871,953-999
Classification Level Classification E-value
Superfamily TPR-like 0.00379
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number - Region: 1217-1288
Classification Level Classification E-value
Superfamily TPR-like 0.0986
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WIN9
Sequence length 2014
Comment (tr|K9WIN9|K9WIN9_9CYAN) Putative ATPase {ECO:0000313|EMBL:AFZ19629.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3921 OC=Microcoleaceae; Microcoleus.
Sequence
MITIPGYQIINQIYESANSIVYRGIREQDSNTVILKVLKQDYPTPQELTRYKQEYEITRN
LNIDGVVKAYALEPYQRTLVIILEDFGASSLKQLFNGSVDAGHVLSLAKFLKLAIKIAEI
LGAIHSGNIIHKDINLANIVFNPETEIIKIIDFGISTQLTRENPTLKNPNVLEGTLAYMS
PEQTGRMNRSLDYRTDFYSLGVTFYELLTGHLPFASSEALELVHCHIAKQPIPPHLLGGE
EETGALVRSRGGEPCPKAVSDIVMKLMAKTAEERYQSAWGLKADLEECLFQLQANGTIAD
FPLGSKDISDKFQIPQKLYGRESEVKTLLTAFDRVSQGTTEMMLVAGYSGIGKSVLVAEV
HKPITQKRGYFISGKFDQFQRNIPYSAVVSAFAGLVRQLLTESEAQLNLWREKLLAAFGS
NGQVIIEVIPEVELIIGKQPPVPELSSTESQNRFNLVFQNLIRAFCAKEHPLVIFLDDLQ
WADSATLKLIELMMTDTDTQYLFLIGAYRNNEVNPTHPLMITLEGVRNLGATINFITLAP
LDSKHISQLIADTLHSDASSVKPLAELVVHKTGGNPFFVYEFLKTLHAENLITFDLEYHG
WQWNVSNIEAKGITDNVVELMIGKLKKLPPVTQQVLRLAACVGADFDLNTLSIISEKSTS
EVCKDLTVAVQSGLILPTSELDEELLIQDYKFLHDRVQQAAYSLIDEKHKQEIHLKIGRL
LLNKFEKYELEERIFDIVNHLNTGQSLLGDKWEKEQLARLNLIAGRKAKLSSAYQPALIY
ITNGIKLLPPNSWEEDYHQTFSYHLEKGEIEYLTASWDEALSTFDEALEHIDSLLDRCKV
NEYKVTLYRMKNDLESSLYLGVQTLELLGINLKAFPEEDELIAEVNQANETIAARKIENF
IDLPEMQDPEKLAAMVLLRECVPPSYFLGSRLLFILGIKMIELSLTYGNSPHSSVGYIYY
SLTLAFVAQDFETAYKFGNLALRLNDDKYQMKRYEALILNMWGGFVSHYTEPLDRSKEHL
MRGYYSGVANGAYQWAGYCAINFLFMCFWGTDSLKELSEEIDKIIPGLKKVDPNMVQYYY
AIKATIYNLIEPVEDWSVLNESLWPNAKEIIKSCLEKNDLFTVFIEIACKLSLANWYSDS
EKAIEYANSAEKYLLGATGIFINPAFHFHQCLALSVGYDYADGEKQAQYVEKIQSNLEKF
KLWSKHCPSTYLHQRLLIEAELARITGNALEAQDLYDQAISSARENKFLQNEALASELAA
KFWLGKGKEKIARVYMSEAHYGYQRWGAKRKMEDLEEKYPQLVAKSSGVRSITETPTATT
RSTSTGTGVALDIATVMKASQAISGEIVLDKLLTALMRILIENAGAQCGYLILETEEKLR
IEASGSVNSDNITVLQSIPIESDRRVSQTIINYVARTCESVVLNDATHEGNFTNDPYIKE
HQPKSILCVPLINQGKLTSIVYLENNLTTGAFTPDRLEVLKVLSSSAAISIENARLYADL
AESNRTLETKVEERTAELGVAKEKAEVANKAKSTFLANMSHELRTPLNAILGFSQLMTRS
KTLPPEHIENVGIISRSGEHLLTLINNVLDLSKIEAGRTTLNETNFDLYRLLDDLEDMFR
FKANDKGLQLICERASDVPQYMRTDETKLRQILINLLSNALKFTKQGGVSVRVGMNNSQS
LKATGKESGISPKKLAITFEIEDTGAGMAAEELDTLFEAFVQTKTGKESQEGTGLGLPIT
RSFVQLMGGKITVRSSVGKGTLFKFDILVSPVDAASITTKQPTRQVIALEPNQPRYRILI
ADDKWSNRQLLIKLLNPLGFELREASNGKEAVEIWDEWEPHLIWMDMQMPVMDGYEATKQ
IKATIKGQATAVIALTATSLEEERAVVLSAGCDDFIRKPFREADIFDTMNKHIGVRYIYE
DVRDVQSLTTINTNTSVDIQEILTPTALAALPFDLLTNLEEATIRSKMNQIDSLINEIRT
LDAPLADALAILAEGFEYPKIASLIGQAKETLRS
Download sequence
Identical sequences K9WIN9
gi|428312058|ref|YP_007123035.1| WP_015183768.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]