SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WIQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WIQ3
Domain Number 1 Region: 359-556
Classification Level Classification E-value
Superfamily TPR-like 1.2e-19
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WIQ3
Sequence length 633
Comment (tr|K9WIQ3|K9WIQ3_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ19417.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3697 OC=Microcoleaceae; Microcoleus.
Sequence
MPDSRPLRDQYIELIDEIVQATLKGKIRSKEQVYQMLLQGVSTGTGEIFDRCLDEQMNAT
QQQVDNPVSEMKQAKAIRSLRALKTLSGEWERVQEKKRTSQALTGAVQAITTVDSSERLT
ALLRVIDPNRQQVLNLQQLAQLGKDLQQQAQQSSDPDTAQELQQLSQGITAGLTSWQRLE
DYVVSWIYDQNQGLGFEGLPEQRGPWAVWAKQVNSPLPKSLFQAIAQNQSLHEWVDQQPS
LELSSWVELAVILQCLQRGLVAWFDKMVYDSKMGAKLSISTFIVFAVIWSQLANALSQAI
TLAEREVLINGCFQVSLQILRAFAQRDYFPLYGGVFASLNGNSLRDALNYLDEPLRQVEG
TQEKARILTLLGYSLRAQGLYDRATAFHQQALEIARGAGDRICEIANLNHLSRICVAQKN
YAEAINYSQRALILSRQSGDRLGEANALTNLGYSEVFQAKEQAQLESEVYETAIHYLEQS
LQLLARLGDSLGGGYASQQSQSLCFSSLGIAHVVIEQPQKAITYLEQGWQAAQISGDLYL
QGVNLAYLAQACYSLQNLAQTLYTGSLGAYLLEQIGSSDWRQPAGLLTILQGQLGAEVFQ
TLLEQERSKIIAFIGVDGYDYIPQLLQKYRDSM
Download sequence
Identical sequences K9WIQ3
WP_015183558.1.75295 gi|428311846|ref|YP_007122823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]