SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WJ02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WJ02
Domain Number 1 Region: 262-425
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-36
Family Histidine kinase 0.0046
Further Details:      
 
Domain Number 2 Region: 11-155
Classification Level Classification E-value
Superfamily CheY-like 7.4e-35
Family CheY-related 0.0012
Further Details:      
 
Domain Number 3 Region: 155-196,226-256
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WJ02
Sequence length 426
Comment (tr|K9WJ02|K9WJ02_9CYAN) Histidine kinase,Response regulator receiver domain protein,histidine kinase {ECO:0000313|EMBL:AFZ20158.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4465 OC=Microcoleaceae; Microcoleus.
Sequence
MTFDVEPSDVTPAKILIVDDELELERLIKQRLRKKIIAKEIELIFVHNGKEALDKLKSGH
QIDMVLTDINMPEMDGLTLLNKLREIDETLKAVVISAYGDMKNIRTAMNCGAFDFITKPI
NFEDLAITINKTLKDVKEVRETMKQLQQAQLQLLQQEKMAVLGQLVAGVAHEMNNPLTCI
AGYTELSSEGVRNLINHIRLYQEQFTEPGLEIEQHAKNIKLDYFLERLPRMLSVMTESTS
RLVHISNSLRTFSRGDIDSQVSTNIHEGIDSTLMILQHRLKGNNTRPEIQVIKDYGEIPL
VKCYLGQLNQVFMNILANAIDACEDLNESRSLADITEQPNTITIQTQLSENHQSVVIKIK
DNGTGMTEDVESRIFDQLFTTKPVGQGTGLGLSISRQIVEETHGGSLTCYSVLGEGTEFA
ISIPIA
Download sequence
Identical sequences K9WJ02
gi|428312587|ref|YP_007123564.1| WP_015184294.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]