SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WJH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WJH3
Domain Number 1 Region: 65-407
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.0049
Further Details:      
 
Domain Number 2 Region: 409-536
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 3 Region: 541-667
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 4 Region: 668-787
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000185
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 5 Region: 759-846
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 6 Region: 858-964
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000248
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Weak hits

Sequence:  K9WJH3
Domain Number - Region: 927-1073
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0144
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WJH3
Sequence length 1242
Comment (tr|K9WJH3|K9WJH3_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFZ19924.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4224 OC=Microcoleaceae; Microcoleus.
Sequence
MRDRGRLLQSLNSSSIKFNPLSAPLRPPLRPSALKKQDRRIADAIALMGGCAIAVFPHRT
LAQSNIVPDNTLGAESSVVVPNFNDLPVEAIRGGTQRGQNLFHSFQEFNVSAGRGAYFFS
PNTDIQNILARVTGSNPSQILGTLGTFGESTPNLFLINPNGIIFGQKASLDVGGSFVATT
ANAIRLGDTGLFSASEPQSSNLLAINPNAFFYNQLSNQGQIINRSTATTTVLDTPTIGLQ
VPDGRSLLLVGGDVKLDDGFLSAPGGRVELGGVVQNAIVGLNTNGNELRLSFPTDVARAN
VSLTNASDVNVQAGGGGSIAINAQNLDVLGGSSVQAGISSGLGSPQSEAGDIEINATGTI
TVAGKLSFIANGVSPGGVGKGGDINITTGSLSVTDGGQVNALTRGEGDAGSVMISASNTV
SLDGGGNGNLTGVASTVEEGGVGNAGGINITTGSLFITNGAQLDTRTFGQGNAGSVRITA
TDTVRFDGIGSNGRASAALSDVVEGAVGDGGDIEITTGSLSVINGAQLSASTYGEGKAGS
TRIHASNTVTFDGVSSNGFSSAVFSNVGEGAVGDGGDIEITTGSLEVTNGAQLIAITDGQ
GNAGSVRISATDTVSFDGIGSNGFSTAAVSNVREGAVGDGGDIEITTGSLEVTNGAQLIA
STDGQGNAGSVRISATDTVSFDGVGSNGPSSLAISAVQLGAVGDGGDIMITTGSLKVSNG
ALLLAYTGGQGNAGNVKISASNTVSFDGVGSNGTISGASSSVRPEAVGNGGDIEITTGSL
EVSNGALLIANTFGRGNAGSVRITATDSIRFNGGGAGSSVDTGAIGDGGNIEITTGSLEV
INGTGLAGLSTSTLGQGNAGSVKIIATDTVRFDGGDAFSAVAPGAVGDGGDIEITARSLE
VNNGAVLFATTAGQGNAGNARISATDTVRFDGGDAFSAVAPGAEGDGGNIQIITGSLSLT
DAFISSENLETGTAGDIIISTRQNLEANRSSIRATTQSGDGGNIRLQVGDLLLMRNDSNI
STTAGVAGAGGDGGNININADFVVAVPKEDSDITANAFNGRGGNINITTQGIYGLTFRER
DILASSDITASSQFGLDGDFQLDLLTNVDPSRGLAQLPTNIVDASQQIDRRCTPAAADQK
SSFVVTGRGGLPPSPNEVLQSESVITPDWVTLNSEADNISRVTAPINPTKTASNPLVEAQ
SWVYGANGEVILTAEAPSVTPHKAWSITPSCEVVGREEKEVF
Download sequence
Identical sequences K9WJH3
WP_015184060.1.75295 gi|428312353|ref|YP_007123330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]