SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WJS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WJS7
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 2.36e-53
Family Dimethylarginine dimethylaminohydrolase DDAH 0.032
Further Details:      
 
Weak hits

Sequence:  K9WJS7
Domain Number - Region: 618-700
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000641
Family Pyruvate oxidase and decarboxylase, middle domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WJS7
Sequence length 702
Comment (tr|K9WJS7|K9WJS7_9CYAN) TIGR00300 family protein {ECO:0000313|EMBL:AFZ20650.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4989 OC=Microcoleaceae; Microcoleus.
Sequence
MTDSIRFLMCSPQHYDVDYVINPWMEGNIHKSSRDRAVEQWQKLHYALKDRALVDLVEPQ
PGWPDMVFTANAGLVLGKTVVLSRFLHKERQGEEPYFKQWFESQGYTVHELPKDLPFEGA
GDALLDREGRWLWAGYGFRSELDSHPYLAKWLDIEVVSLRLADERFYHLDTCFCPLTGGY
LLYYPPAFDAYSNRLIEMRVAPEKRIALDEPDAVNFACNAVNIDQVVVMNKASEDLKKRL
TAVGFEVVETPLTEFLKAGGAAKCLTLRVTEPVRAEIHANTAVESRVVRMEGHLLDSGLI
SRALDLVVENGGSFQVLNFNLGEQRQSTSSAEVKVSAPSHDLMEEMMTLLIDLGAVAPPQ
EVCDSNLEPVIQDGVAPDDFYVTTIYPTEVRVNCEWIKVHNQRMDGAIAITHTPDGPVAH
CKLLRDLKVGEHVIVGVEGIRTVRKTESREQRNTQEFSFMASGVSSERRVELVVEQIAWE
LRQLRDRGGKVVVTAGPVVIHTGGSQHLARLIREGYVQALLGGNAIAVHDIEQSLMGTSL
GVDMKRGVPVRGGHRHHLKVINLIRRYGNIAAAVEHGVLTKGVMYECVRNNVPFVLAGSI
RDDGPLPDTEMDLIKAQTEYAKQLEGADMILMLSSMLHSIGVGNMTPAGVKMVCVDINPS
VVTKLSDRGSVESVGVVTDVGLFLSLLVQQLDKLTSPYQAMV
Download sequence
Identical sequences K9WJS7
WP_015184785.1.75295 gi|428313079|ref|YP_007124056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]