SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9WKL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WKL4
Domain Number 1 Region: 533-711
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-34
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 21-87,122-224
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-23
Family GAF domain 0.0048
Further Details:      
 
Domain Number 3 Region: 224-410
Classification Level Classification E-value
Superfamily GAF domain-like 1.29e-23
Family GAF domain 0.004
Further Details:      
 
Domain Number 4 Region: 436-479
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000863
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WKL4
Sequence length 749
Comment (tr|K9WKL4|K9WKL4_9CYAN) Histidine kinase with GAF domain {ECO:0000313|EMBL:AFZ20723.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_5066 OC=Microcoleaceae; Microcoleus.
Sequence
MFPTVNQAFQLLQTLSQSPGRQAALLRKIVDRIRNSLELQVVLQTAVDEVAALLKLDSCI
FLWYLKDTQQIRVVCERTHDSHSYSLLGYYPLESFGSVASAVATGQLMMENGRASPQERL
LPWLIGKPLWLKQLLRQPGQNRQSRGNQLPDNFPENFSQADRQVLGYQANLLIPVTGKED
GIGFMACLSKQPRRWSASEIEFLESIAESLEVAIRQAQLYEQTQKQAIRERLLNHIINQT
RQSFDIETILTEAIAQLLEALQIDRCLVHLVENPHHLDMGKYPPECLATSQKGDAFQRKH
LYEVARPPFSPSIDDFDLTGPITQWVIQHRQQVMIPDITQDERIGANNIEYRKAQIKSSL
VIPVQANGTLQALLYLNQCSHIRDWSKNDQELAQSVADQLAISLQQAYLYACTQQQARES
ALQAQKMSEMLEELRLAQTQLIQSEKMSSLGRMVAGVAHEINNPVNFIYGNIPYVENYVR
DLIRLVQAYQSNYPQPTADIQNLAEETDMDFLLRDLPKILKSMECGAERIHEIVQVLQKF
AGSQVAPLKVIDLNAALESTLLILHSQMNSEIEVERSYDHLPPVECYPKPINQAFLCILT
NAMEALKRSPNSHKVITVQTKWLPSIEIGDMGRVQIAIRDNGLGIQPEIQPRIFEPFFTT
KEVGQGRGLGLTVTYQTIVNQHHGRLDVRSELNQGTEFLLEIPVRHPKPMKSDPVRDQGL
GKMDWRIDRGKNSSPQPSFSSLQTSIPNL
Download sequence
Identical sequences K9WKL4
gi|428313152|ref|YP_007124129.1| WP_015184856.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]